DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and sem-5

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:146 Identity:46/146 - (31%)
Similarity:84/146 - (57%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 VALYPFKAIEGGDLSLEKNAEYEVID-DSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWY 411
            ||.:.|:|....:||.::....:|:: |...||:|. :..||.|:|||||::      :....||
 Worm     4 VAEHDFQAGSPDELSFKRGNTLKVLNKDEDPHWYKA-ELDGNEGFIPSNYIR------MTECNWY 61

  Fly   412 VGDMSRQRAESLLKQGD-KEGCFVVRK-SSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYL-S 473
            :|.::|..||.|||:.. ::|.|:||: .|:.|.:::|:..   |..|:|:.:.::...:||| :
 Worm    62 LGKITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRF---QDSVQHFKVLRDQNGKYYLWA 123

  Fly   474 EKHCCETIPDLINYHR 489
            .|.  .::.:|:.|||
 Worm   124 VKF--NSLNELVAYHR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 19/51 (37%)
SH2_Tec_family 403..505 CDD:198188 27/90 (30%)
PTKc_Tec_like 521..778 CDD:173637
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738 18/49 (37%)
SH2_Grb2_like 56..151 CDD:199828 27/87 (31%)
SH3_GRB2_like_C 158..210 CDD:212739
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.