DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Lck

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001155904.1 Gene:Lck / 16818 MGIID:96756 Length:520 Species:Mus musculus


Alignment Length:464 Identity:193/464 - (41%)
Similarity:280/464 - (60%) Gaps:33/464 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKD-ALGN 388
            |.:|    |.|..:||     ||:||:.::....|||..||..:..:::.|.| |||.:. ..|.
Mouse    64 GSLP----PASPLQDN-----LVIALHSYEPSHDGDLGFEKGEQLRILEQSGE-WWKAQSLTTGQ 118

  Fly   389 VGYIPSNYVKPKALLGLERYEWYVGDMSRQRAE-SLLKQGDKEGCFVVRKS-STKGLYTLSLHTK 451
            .|:||.|:| .|| ..||...|:..::||:.|| .||..|:..|.|::|:| ||.|.::||:. .
Mouse   119 EGFIPFNFV-AKA-NSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVR-D 180

  Fly   452 VPQSH---VKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC--DRPVPPT 511
            ..|:.   ||||.|:......:|:|.:.....:.||:.::.:.|.||..:| |.||  .:|..| 
Mouse   181 FDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKL-SRPCQTQKPQKP- 243

  Fly   512 AGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKL 576
              ...|:||:....|.|:|.||:||||.|..|.:.|....|||.:|:|:||.|.|:.||.:|.:|
Mouse   244 --WWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQL 306

  Fly   577 QHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIG---NMGLLLDMCIQVSKGMTYL 638
            |||.||:||.|.:: .||||:||||::|||:::|    ||..|   |:..||||..|:::||.::
Mouse   307 QHPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFL----KTPSGIKLNVNKLLDMAAQIAEGMAFI 366

  Fly   639 ERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSK 703
            |..|||||||.|.|.||......|:|||||||.:.|::||:..|.||||||..||.:||..|:.|
Mouse   367 EEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK 431

  Fly   704 SDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERP 768
            ||||::|:|:.||.|.|::||..:.|.||::.::||..:.:|.:|.:|:|.:|.|||...||:||
Mouse   432 SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRP 496

  Fly   769 AFRVLMDQL 777
            .|..|...|
Mouse   497 TFDYLRSVL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 20/53 (38%)
SH2_Tec_family 403..505 CDD:198188 36/108 (33%)
PTKc_Tec_like 521..778 CDD:173637 124/260 (48%)
Pkinase_Tyr 526..777 CDD:285015 123/253 (49%)
LckNP_001155904.1 SH3_Lck 76..129 CDD:212938 20/54 (37%)
SH2_Src_Lck 134..234 CDD:198225 33/101 (33%)
PTKc_Lck_Blk 248..511 CDD:270652 126/263 (48%)
Pkinase_Tyr 256..505 CDD:285015 123/253 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.