DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Jak3

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001177759.1 Gene:Jak3 / 16453 MGIID:99928 Length:1100 Species:Mus musculus


Alignment Length:312 Identity:100/312 - (32%)
Similarity:144/312 - (46%) Gaps:51/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 PTAGLSHDKWEI---------------HPMELMLMEELGSGQFGVVR------RGKWRGSIDTAV 553
            ||.|:...:.|:               ....|..:..||.|.||.|.      .|...|.:....
Mouse   787 PTPGIPSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVK 851

  Fly   554 KMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVC--SKHRPIYIVTEYMKHGSLLNYLRRHEKT 616
            ::...|...:.||..|.:::..|....:|:..||.  ...:.:.:|.||:..|.|.::|:||...
Mouse   852 QLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRAR 916

  Fly   617 LIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVL--DDQYTS 679
            |  :...||....|:.|||.||.....:||||||||.||.||..||:||||||:.:.  .|.|..
Mouse   917 L--HTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVV 979

  Fly   680 SGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFT-CGKM------------------PYG 725
            ....:.||.|..||.|:...||.:||||::||:::|:|| |.|.                  |..
Mouse   980 REPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLSMMGPEREGPPLC 1044

  Fly   726 RLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            ||     :|.:..|..|..|.:|..|:.::|:|||:..|.:||||..|..||
Mouse  1045 RL-----LELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQL 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 96/301 (32%)
Pkinase_Tyr 526..777 CDD:285015 94/279 (34%)
Jak3NP_001177759.1 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..223
B41 41..246 CDD:214604
FERM_C_JAK3 250..359 CDD:275413
SH2 359..455 CDD:301589
PKc_like 517..774 CDD:304357
Pkinase_Tyr 517..773 CDD:285015
PKc_like 813..1095 CDD:304357 96/286 (34%)
Pkinase_Tyr 818..1091 CDD:285015 94/279 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.