DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and CSK

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001120662.1 Gene:CSK / 1445 HGNCID:2444 Length:450 Species:Homo sapiens


Alignment Length:441 Identity:166/441 - (37%)
Similarity:252/441 - (57%) Gaps:26/441 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 VALYPFKAIEGGDLSLEKNAEYEVIDDSQE-HWWKVKDALGNVGYIPSNYVKP----KALLGLER 407
            :|.|.|......||...|.....::..::: :|:|.|:.:|..|.||:|||:.    ||...|..
Human    15 IAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG
VKAGTKLSL 79

  Fly   408 YEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST-KGLYTLSLHTKVPQSHVKHYHIKQNARCEYY 471
            ..|:.|.::|::||.|| ...:.|.|:||:|:. .|.|||.:..   ...|:||.|..:| .:..
Human    80 MPWFHGKITREQAERLL-YPPETGLFLVRESTNYPGDYTLCVSC---DGKVEHYRIMYHA-SKLS 139

  Fly   472 LSEKHCCETIPDLINYHRHNSGGLACRL-KSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSG 535
            :.|:...|.:..|:.::..::.||..|| |....:..|..........|.::..||.|::.:|.|
Human   140 IDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEG
TVAAQDEFYRSGWALNMKELKLLQTIGKG 204

  Fly   536 QFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHR-PIYIVTE 599
            :||.|..|.:||: ..|||.:|....:: .|:.||.|||:|:|.|||||.||..:.: .:|||||
Human   205 EFGDVMLGDYRGN-KVAVKCIKNDATAQ-AFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTE 267

  Fly   600 YMKHGSLLNYLRRHEKTLIGNMGLL---LDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVV 661
            ||..|||::|||...::::|...||   ||:|    :.|.|||.:|::||||||||.||..:||.
Human   268 YMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVC----EAMEYLEGNNFVHRDLAARNVLVSEDNVA 328

  Fly   662 KVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGR 726
            ||:||||.:.....|.|.    |.|:||..||.|...:||:|||||::|:|:|||::.|::||.|
Human   329 KVSDFGLTKEASSTQDTG----KLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPR 389

  Fly   727 LKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            :...:||.||::|..::.|..|...:|:|||.||......||:|..|.:||
Human   390 IPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 16/51 (31%)
SH2_Tec_family 403..505 CDD:198188 30/103 (29%)
PTKc_Tec_like 521..778 CDD:173637 116/261 (44%)
Pkinase_Tyr 526..777 CDD:285015 113/254 (44%)
CSKNP_001120662.1 Interaction with PTPN22. /evidence=ECO:0000250|UniProtKB:P41241 9..70 16/54 (30%)
SH3_CSK 11..67 CDD:212703 16/51 (31%)
SH2_csk_like 78..175 CDD:198190 29/101 (29%)
PTKc_Csk 188..443 CDD:133213 117/263 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.