DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Blk

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_031575.2 Gene:Blk / 12143 MGIID:88169 Length:499 Species:Mus musculus


Alignment Length:453 Identity:182/453 - (40%)
Similarity:269/453 - (59%) Gaps:16/453 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 PGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDAL-GNVGYIP 393
            |.:||....:...|   ||||:.:.|:...||.:.|..:.:|:..:.: ||..:..: |..||:|
Mouse    43 PPSPNQDPDEEERF---VVALFDYAAVNDRDLQVLKGEKLQVLRSTGD-WWLARSLVTGREGYVP 103

  Fly   394 SNYVKPKALLGLERYEWYVGDMSRQRAE-SLLKQGDKEGCFVVRKS-STKGLYTLSLHTKVPQSH 456
            ||:|.|...|.:|:  |:...:||:.|| .||...:|.|.|::|:| |.||.::||:.....|..
Mouse   104 SNFVAPVETLEVEK--WFFRTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDITTQGE 166

  Fly   457 -VKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWE 520
             ||||.|:......||:|.:....|:..|:.::.....|| |:..:.||....|... .:.|:||
Mouse   167 VVKHYKIRSLDNGGYYISPRITFPTLQALVQHYSKKGDGL-CQKLTLPCVNLAPKNL-WAQDEWE 229

  Fly   521 IHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLY 585
            |....|.|:.:|||||||.|..|.::.::..|:|.:||||||.:.|:.||.||..|||..||:||
Mouse   230 IPRQSLKLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLY 294

  Fly   586 GVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAA 650
            .|.:: .|||||||||..|.||::|:..|.:.: ::..|:||..||::||.|:||.|.|||||.|
Mouse   295 AVVTR-EPIYIVTEYMARGCLLDFLKTDEGSRL-SLPRLIDMSAQVAEGMAYIERMNSIHRDLRA 357

  Fly   651 RNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWE 715
            .|.||......|:||||||| ::|.:||:..|.||||||..||.:::..|:.|:|||::|||:.|
Mouse   358 ANILVSETLCCKIADFGLAR-IIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLME 421

  Fly   716 IFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIY-DVMKLCWSHGPEERPAFRVLMDQL 777
            |.|.|::||..:.|.||:..::.|..:..|::|..|:| |::..||...|||||.|..|...|
Mouse   422 IVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYNDIITECWRGRPEERPTFEFLQSVL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 18/53 (34%)
SH2_Tec_family 403..505 CDD:198188 34/104 (33%)
PTKc_Tec_like 521..778 CDD:173637 120/258 (47%)
Pkinase_Tyr 526..777 CDD:285015 118/251 (47%)
BlkNP_031575.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
SH3 56..109 CDD:302595 19/56 (34%)
SH2_Src_Blk 114..213 CDD:198234 32/101 (32%)
PKc_like 227..490 CDD:304357 122/261 (47%)
Pkinase_Tyr 235..484 CDD:285015 118/251 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.