DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and MERTK

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_006334.2 Gene:MERTK / 10461 HGNCID:7027 Length:999 Species:Homo sapiens


Alignment Length:334 Identity:113/334 - (33%)
Similarity:173/334 - (51%) Gaps:37/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 YLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSG 535
            |:::|..|....:|..:....|..|..:|:....||.:                 |:|.:.||.|
Human   549 YIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNL-----------------LILGKILGEG 596

  Fly   536 QFGVVRRGKWR----GSIDTAVKMMKEGTMSE---DDFIEEAKVMTKLQHPNLVQLYGVCSK--- 590
            :||.|..|..:    .|:..|||.||....|:   ::|:.||..|....|||:::|.|||.:   
Human   597 EFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSS 661

  Fly   591 ---HRPIYIVTEYMKHGSLLNYLRRHEKTLIG----NMGLLLDMCIQVSKGMTYLERHNYIHRDL 648
               .:|: ::..:||:|.|..|| .:.:...|    .:..||...:.::.||.||...|::||||
Human   662 QGIPKPM-VILPFMKYGDLHTYL-LYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDL 724

  Fly   649 AARNCLVGSENVVKVADFGLARYVLDDQYTSSGG-TKFPIKWAPPEVLNYTRFSSKSDVWAYGVL 712
            |||||::..:..|.||||||::.:....|...|. .|.|:||...|.|....::|||||||:||.
Human   725 AARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVT 789

  Fly   713 MWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            ||||.|.|..||..::|.|:.:.:..|..|::|:.|..|:|::|..||...|.:||.|.||..||
Human   790 MWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQL 854

  Fly   778 ALVAQTLTD 786
            ..:.::|.|
Human   855 EKLLESLPD 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 7/33 (21%)
PTKc_Tec_like 521..778 CDD:173637 101/274 (37%)
MERTKNP_006334.2 Ig 111..176 CDD:409353
Ig strand B 111..115 CDD:409353
Ig strand C 127..131 CDD:409353
Ig strand E 158..162 CDD:409353
Ig strand F 172..176 CDD:409353
IgI_2_Axl_Tyro3_like 198..279 CDD:409407
Ig strand A 198..201 CDD:409407
Ig strand A' 204..208 CDD:409407
Ig strand B 212..221 CDD:409407
Ig strand C 226..233 CDD:409407
Ig strand C' 235..238 CDD:409407
Ig strand E 243..254 CDD:409407
Ig strand F 257..266 CDD:409407
Ig strand G 270..279 CDD:409407
FN3 284..378 CDD:238020
FN3 386..478 CDD:238020
PTKc_Mer 579..862 CDD:271106 104/301 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.