DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and map3k13

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_002936577.1 Gene:map3k13 / 100493878 XenbaseID:XB-GENE-5753317 Length:963 Species:Xenopus tropicalis


Alignment Length:310 Identity:104/310 - (33%)
Similarity:157/310 - (50%) Gaps:29/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 INYHRHNSGGLACRLKSSPCDRPVPPTAGLSH---------DKWEIHPMELMLMEELGSGQFGVV 540
            |::.|..||..........|.|||....|.::         |.||:...|:..::.||||..|.|
 Frog   119 IHFSRSGSGNGGFLEGLFGCLRPVWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQGAV 183

  Fly   541 RRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY-IVTEYMKHG 604
            ..||:||. :.|:|.::|  ..|.|.    |.:.||:|||::...|||:: .|.| ::.||..||
 Frog   184 FLGKFRGE-EVAIKKVRE--QKETDI----KHLRKLKHPNIIAFKGVCTQ-APCYCLIMEYCAHG 240

  Fly   605 SLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLA 669
            .|...||...|.   ...||:|....::.||.||..|..|||||.:.|.||...:.||::|||.:
 Frog   241 QLYEVLRAGRKV---TPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHADTVKISDFGTS 302

  Fly   670 RYVLDDQYT--SSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEV 732
            : .|.|:.|  |..||   :.|..|||:.....|.|.|:|::|||:||:.| |::||..:.::.:
 Frog   303 K-ELSDKSTKMSFAGT---VAWMAPEVIRNEPVSEKVDIWSFGVLLWELLT-GEIPYKDVDSSAI 362

  Fly   733 VERV-QRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVA 781
            :..| ...:.|..|.:|......:||..|...|..||:||.::..|.:.:
 Frog   363 IWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQILMHLDIAS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 4/19 (21%)
PTKc_Tec_like 521..778 CDD:173637 91/260 (35%)
Pkinase_Tyr 526..777 CDD:285015 90/254 (35%)
map3k13XP_002936577.1 STKc_MAP3K12_13 175..411 CDD:270961 91/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.