DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and jak3

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001107517.1 Gene:jak3 / 100135373 XenbaseID:XB-GENE-5904698 Length:1107 Species:Xenopus tropicalis


Alignment Length:325 Identity:106/325 - (32%)
Similarity:158/325 - (48%) Gaps:51/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 GGLACRLKSSPCDRPVPPTAGLSHDKWEI------HPMELMLMEELGSGQFGVVR------RGKW 545
            |||..      ||.           .||:      ....|..:..||.|.||.|.      .|..
 Frog   799 GGLRV------CDH-----------AWELQDPTVYEERHLKYISVLGKGNFGSVELCRYDPLGDN 846

  Fly   546 RGSIDTAVKMMKEGTMSE-DDFIEEAKVMTKLQHPNLVQLYGVC--SKHRPIYIVTEYMKHGSLL 607
            .|.: .|||.::..|:.. .||..|::::..|....:|:..|:|  :..|...::.||:.:|||.
 Frog   847 TGEL-VAVKKLQHHTVEHVRDFQRESRILRSLHSDFIVKYKGICYSAGRRSFQLIMEYLPNGSLR 910

  Fly   608 NYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYV 672
            .||.:::..| |...||| ...|:.|||.||....|:|||||:||.||.|...||:.||||.:.:
 Frog   911 EYLPKNQNVL-GPCHLLL-YASQICKGMLYLGSQRYVHRDLASRNVLVESREHVKIGDFGLTKIL 973

  Fly   673 LDDQ--YTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGK------MPYGRLKN 729
            ..|:  |......:.||.|..||.|:.:.:|.:||||::|||::|:||..:      ..|.|:..
 Frog   974 PQDKEYYVVREKGESPIFWHAPESLSDSIYSRESDVWSFGVLLYELFTYSQRSCSPPTEYLRMMG 1038

  Fly   730 --------TEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQTLTD 786
                    ..:||.::.|..|..|.||..|:|.:|..|||..|.|||:|:.|..|:..:.::||:
 Frog  1039 PHNAQQTVCSLVEFLRAGKRLCTPASCPTEVYKLMLSCWSSLPSERPSFKDLELQVEQLQESLTN 1103

  Fly   787  786
             Frog  1104  1103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 3/11 (27%)
PTKc_Tec_like 521..778 CDD:173637 97/287 (34%)
Pkinase_Tyr 526..777 CDD:285015 96/275 (35%)
jak3NP_001107517.1 B41 39..259 CDD:214604
FERM_B-lobe 139..250 CDD:271216
FERM_C_JAK3 255..364 CDD:275413
SH2_Jak3 364..459 CDD:198243
PTK_Jak3_rpt1 520..779 CDD:271110
Pkinase_Tyr 520..778 CDD:285015
PTKc_Jak3_rpt2 816..1098 CDD:270665 97/284 (34%)
TyrKc 821..1097 CDD:197581 97/278 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.