DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and NUP58

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_054808.1 Gene:NUP58 / 9818 HGNCID:20261 Length:599 Species:Homo sapiens


Alignment Length:252 Identity:61/252 - (24%)
Similarity:81/252 - (32%) Gaps:71/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1322 TPAPCDYHPEQCQVDSTPAFTFGMRLGRERISDTPAPSAYEPEKHSLHSTPAYSFGTKSDIRVTT 1386
            |||            :|.|.|.|..||..:    ||.|| .|....:.||.|......|      
Human    97 TPA------------TTSAATTGFSLGFNK----PAASA-TPFALPITSTSASGLTLSS------ 138

  Fly  1387 DAPAPGHYHPEQCKLDSSPAYSFGL---------KTVPTASLPEPRGAYIEDRIVQRRERRLASP 1442
                         .|.|:||.|.|.         .|..|||.....|.            .||..
Human   139 -------------ALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGG------------ALAGL 178

  Fly  1443 VRNNAECTTTTTNHTNNNA-GSSTTTTTTTTTTTKTFINGVEQPELQKKETTKQVNGTH----KE 1502
            ..:..:.|.|.|:....|| |.:..||..|:|.....:.|::......|::.|  .||.    |.
Human   179 GGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDK--TGTRPEDSKA 241

  Fly  1503 LKSAPQAPLSNGNIVSNGNHSKMVSTTTRIQEVAHGQKESGNLKVVASGKSDASATK 1559
            ||.....|:...::   .|..|.|....::||..........|||    :.|..|.|
Human   242 LKDENLPPVICQDV---ENLQKFVKEQKQVQEEISRMSSKAMLKV----QEDIKALK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
NUP58NP_054808.1 Nucleoporin_FG2 3..599 CDD:406391 61/252 (24%)
14 X 2 AA repeats of F-G 7..579 61/252 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..247 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.