DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and NUP100

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_012855.1 Gene:NUP100 / 853796 SGDID:S000001551 Length:959 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:65/347 - (18%)
Similarity:95/347 - (27%) Gaps:170/347 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly  1376 FGTKSDIRVTTDAPAPGHYHPEQCKLDSSPAYSFGLKTVPTASLPEPRGAYIEDRIVQRRERRLA 1440
            ||||         ||            |:....||..|..| ::|...|.:              
Yeast   464 FGTK---------PA------------STTGSLFGNNTAST-TVPSTNGLF-------------- 492

  Fly  1441 SPVRNNAECTTTTTN--------------------HTNNNAGSST-------------------- 1465
               .|||..:|:|||                    ..|:|:.|||                    
Yeast   493 ---GNNANNSTSTTNTGLFGAKPDSQSKPALGGGLFGNSNSNSSTIGQNKPVFGGTTQNTGLFGA 554

  Fly  1466 --TTTTTTTTTTKTF----------------INGVEQ---------PELQK-------------- 1489
              |.::...:|.|.|                :|...|         |.||:              
Yeast   555 TGTNSSAVGSTGKLFGQNNNTLNVGTQNVPPVNNTTQNALLGTTAVPSLQQAPVTNEQLFSKISI 619

  Fly  1490 --------KETTKQVNGTHKELKS-------APQ---APLSNGN--------IVSNGNHSKMVST 1528
                    |.||.:||...|...|       ||:   ||.|||:        .:...:.....|.
Yeast   620 PNSITNPVKATTSKVNADMKRNSSLTSAYRLAPKPLFAPSSNGDAKFQKWGKTLERSDRGSSTSN 684

  Fly  1529 TTRIQEVAHGQ------------------KESGNLKVVASGKSDASATKAAAVSHQTVVQADGAI 1575
            :....|.::..                  |.:.||.|:.....:||..|....:.::..:.|.| 
Yeast   685 SITDPESSYLNSNDLLFDPDRRYLKHLVIKNNKNLNVINHNDDEASKVKLVTFTTESASKDDQA- 748

  Fly  1576 VTSGQSSRMQTVKYAVEASSVQ 1597
                 ||.:...|...:|.|.|
Yeast   749 -----SSSIAASKLTEKAHSPQ 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
NUP100NP_012855.1 Nucleoporin_FG2 54..>246 CDD:406391
ser_rich_anae_1 <290..>566 CDD:411418 26/140 (19%)
Nucleoporin_FG 429..509 CDD:404514 20/83 (24%)
Nucleoporin2 814..955 CDD:397975
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.