DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and NUP145

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_011423.1 Gene:NUP145 / 852788 SGDID:S000003060 Length:1317 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:67/320 - (20%)
Similarity:104/320 - (32%) Gaps:73/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1341 FTFGMRLGRERISDTPAPSAYEPEKHSLHSTPAYSFGTKSDIRV--TTDAPAPG----HYHPEQC 1399
            ||||.:       :|..|::...:..|....|..|.|...::.|  .|..|:|.    :.:....
Yeast    10 FTFGNQ-------NTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNAN 67

  Fly  1400 KLDSSPAYS--FGLKTVPTASLPEPRGAYIEDRIVQRRERRLASPVRNNAECTTTTTNHT----- 1457
            .:...||.:  ||.|..      :|.|...  ........:.|..:..|...|..:|..|     
Yeast    68 SISQQPANNSLFGNKPA------QPSGGLF--GATNNTTSKSAGSLFGNNNATANSTGSTGLFSG 124

  Fly  1458 NNNAGSST-----------TTTTTTT---------TTTKTFINGVEQPELQKKETTKQVNGTHKE 1502
            :||..|||           ...|:||         |||.....|:.........||......:.:
Yeast   125 SNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSNNTQ 189

  Fly  1503 LKSA-----PQAPLSNGNIVSNG-NHSKMVSTTTRIQEVAHGQKESGNLKVVA------------ 1549
            ..:.     |.|..:.|...:|| :..:...||..:....:|...|.....||            
Yeast   190 SSTGIFGQKPGASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMAVADMPRSITSSLSD 254

  Fly  1550 -SGKSDAS---ATKAAAVSHQTVVQADGAIVTSGQS---SRMQTVKYAVEASSVQEKIIS 1602
             :|||||.   .......|..:.|..:..:..:.||   ||:.|...|.:.|:...:|.|
Yeast   255 VNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRLKATQKSTSPNEIFS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
NUP145NP_011423.1 Nucleoporin_FG 34..122 CDD:404514 19/95 (20%)
Nucleoporin_FG 89..209 CDD:404514 22/121 (18%)
Nucleoporin2 460..605 CDD:397975
Nup96 898..1150 CDD:403363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.