DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and NUP49

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_011343.1 Gene:NUP49 / 852703 SGDID:S000003140 Length:472 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:51/259 - (19%)
Similarity:89/259 - (34%) Gaps:85/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1368 LHSTPAYSFGTKSDIRVTTDAPAPGHYHPEQCKLDSSPAYS---FGLKTVPTASLPEPRGAYIED 1429
            :::..|..||:|         ||.|..........|:||.:   ||.|         |.|     
Yeast   142 MNNASAGLFGSK---------PAGGTSLFGNTSTSSAPAQNQGMFGAK---------PAG----- 183

  Fly  1430 RIVQRRERRLASPVRNNAECTTT-----------------TTNHTNNNAGSSTTTTTTTTTTTKT 1477
                      .|...|||..|||                 ::|:.|||..|:...:.:..     
Yeast   184 ----------TSLFGNNAGNTTTGGGLFGSKPTGATSLFGSSNNNNNNNNSNNIMSASGG----- 233

  Fly  1478 FINGVEQPELQKKETTKQVNGTHKELKSAPQAPLSNGNIVSNGNHSKMVSTTTRIQEV-AHGQKE 1541
             :.|.:|.:||::   .|:....:.|...|..|:                  |||.|: ...::|
Yeast   234 -LFGNQQQQLQQQ---PQMQCALQNLSQLPITPM------------------TRISELPPQIRQE 276

  Fly  1542 SGNL-KVVASGKSDASATKAAAVSHQTVVQA---DGAIVTSGQSSRMQTVKYAVEASSVQEKII 1601
            ...| :.:......:...||..:.|..::.:   |.|.:...:|:..|.:|..::..|..:.:|
Yeast   277 IEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVAYLLKSESATSQYLKQDLKKISSFKSLI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
NUP49NP_011343.1 Nucleoporin_FG2 29..>289 CDD:406391 41/206 (20%)
V_Alix_like <267..465 CDD:353824 13/74 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.