DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Stpg3

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:XP_011237505.1 Gene:Stpg3 / 74472 MGIID:1921722 Length:313 Species:Mus musculus


Alignment Length:289 Identity:65/289 - (22%)
Similarity:85/289 - (29%) Gaps:136/289 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QRPVALKTFQIPGPNYYQVVPLDVVKRRAPRYSFRIKVNVYLVNNPAPNSYCPEKVTQSKKNAPR 218
            :||..|....:|||..|:|          |..|.|         ..:|:              |:
Mouse   100 RRPPILMDLDVPGPAQYEV----------PNMSLR---------EASPH--------------PQ 131

  Fly   219 YTFGRRTKIEHDQGT--------------------------PAPGAYCPEKVKLNKTPEFSFGIK 257
            ||.||:..:....|.                          |:|..|.|  :.....|.||||.:
Mouse   132 YTIGRKYPVREGGGRRAWQTMWLQSESPFMQKTDFNRETKWPSPAEYTP--LSQPAFPAFSFGDR 194

  Fly   258 HHEQ--------RP---------DYTPAPGTYKPEQVVLEHIPAYSFGLKTKHIQVSDTPAPGAY 305
            |...        ||         .|||...|.||.            |.|        .|:|..|
Mouse   195 HRSVVKMPESRFRPGMLRARGPCSYTPLLPTSKPS------------GEK--------RPSPNTY 239

  Fly   306 SPEKS-RLHS--APAYSIAGKASQDVVDCTPAPGAYEPEKCVLSRTPAFSFGHRAELAKSSDTPA 367
            :.... ||.|  :||:|                         :||:|||     |....||.||.
Mouse   240 NILPGYRLQSTRSPAFS-------------------------MSRSPAF-----ASWVSSSGTPG 274

  Fly   368 PGTYNPE---KVRLDHTPAFTLSG--RPE 391
            |..|..|   ..|...:|...:.|  ||:
Mouse   275 PAAYYVEDCYNSRFPSSPGVVIQGVRRPK 303



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21580
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.