DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Odf3

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_081295.2 Gene:Odf3 / 69287 MGIID:1916537 Length:254 Species:Mus musculus


Alignment Length:258 Identity:86/258 - (33%)
Similarity:117/258 - (45%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGGNVEQRPWTPTVRIGKIAAETTNPGPATVQLPTLIGSKVPDSKKKAAPSYSFGHKLGGKYDTS 91
            |...|....|.|....|.|.|..::|||..: :|...|.......|..||:|||........:..
Mouse     1 MAEEVWMGTWRPHRPRGPIMALYSSPGPKYL-IPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENC 64

  Fly    92 GPGPAQYNVTGMRAK-GRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQR 155
            .||| :|:|.....| |:|...|.::..|....|..: ||||:|....:.|.|.|:.|.::...|
Mouse    65 SPGP-RYSVNPKILKTGKDLGPAYSILGRYHTKTLLT-PGPGDYFPEKSTKYVFDSAPSHSISAR 127

  Fly   156 PVALKTFQI---PGPNYYQVV----PLDVVKRRAPRYSF--RIKVNVY---LVNNPAPNSYCPEK 208
               .|||::   |||..|.:.    |..|.|...|.:|.  |.|:..:   |...|.|.:|...:
Mouse   128 ---TKTFRVDSTPGPAAYMLPVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTE 189

  Fly   209 VTQSKKNAPRYTFGRRTKIEHDQG-TPAPGAYCPEKVKLNK--TPEFSFGIKHHEQRPDY-TP 267
            |..:|..||:||...|.:...|:. .|.|||:.||||.|||  .|..:|||||    .|| ||
Mouse   190 VQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKH----SDYMTP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Odf3NP_081295.2 STPGR 1 180..205 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..228 9/20 (45%)
STPGR 2 216..241 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100875
Panther 1 1.100 - - O PTHR21580
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.