DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and odf3

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001015830.1 Gene:odf3 / 548547 XenbaseID:XB-GENE-5889414 Length:256 Species:Xenopus tropicalis


Alignment Length:255 Identity:87/255 - (34%)
Similarity:118/255 - (46%) Gaps:18/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGGNVEQRPWTPTVRIGKIAAETTNPGPATVQLPTLIGSKVPDSKKKAAPSYSFGHKLGGKYDTS 91
            ||.:|....|.|....|.|||..::||| ...||...|....|..:..||:||.|::.....|..
 Frog     1 MGTDVWVGSWRPHRPRGPIAALYSSPGP-KYSLPGNTGFVSHDPSRYRAPAYSMGNRRFKFVDDC 64

  Fly    92 GPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRP 156
            .|||.....:.:..||:|...|.::..|||:::.|..||||.|....|.|:...:.|.|:.|:|.
 Frog    65 SPGPGYLVPSNITVKGKDGTPAYSIYGRPKDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERT 129

  Fly   157 VALKTFQIPGPNYY---QVVPLDVVKR-RAPRYSF--RIKVNVY---LVNNPAPNSYCPEKVTQS 212
            ......|.|||..|   .|:...:|.| .||.||.  |.|:..:   |...|.|.:|........
 Frog   130 KTFSNDQTPGPAAYVLPSVIGPRIVNRISAPNYSMTGRSKIGSFHEDLQRTPGPGTYRVIDPGSY 194

  Fly   213 KKNAPRYTFGRRTKIEHDQG-TPAPGAYCPEKVKLNK--TPEFSFGIKHHEQRPDYTPAP 269
            |...|:|:...|..:..|.. .|.||||.||||.:::  .|.|||||:|    .||. ||
 Frog   195 KHRPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSRPQAPNFSFGIRH----SDYV-AP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
odf3NP_001015830.1 STPGR 1 66..92 7/25 (28%)
STPGR 2 181..206 6/24 (25%)
STPGR 3 217..242 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11360
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 1 1.000 - - otm47880
Panther 1 1.100 - - O PTHR21580
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.