DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Stpg3

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:XP_006233711.1 Gene:Stpg3 / 499746 RGDID:1561978 Length:321 Species:Rattus norvegicus


Alignment Length:303 Identity:66/303 - (21%)
Similarity:104/303 - (34%) Gaps:107/303 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1154 PNETPAPGAYSPEKVRQDHNPAFTMAGKHDPKVTH-DTPAPGDYHPEKVRL---DHNPAFS---- 1210
            |||:...|..:..::..:..|         |.:|. |.|.|..|....|.|   ..:|.::    
  Rat    74 PNESTPIGTGTLRELWLERRP---------PILTDLDVPGPTQYEAPNVSLRESSPHPQYTIGRK 129

  Fly  1211 FAGR--------HDLHKPSETPAPGDYFPEKVRQDFNPAFTFAGKHDPRSLSESPAPGDYSPEKV 1267
            :.||        ..:...||:|     |.:|.  |||..            ::.|:|.:|:|  :
  Rat   130 YPGREGGGRRAWQTMWLQSESP-----FTQKT--DFNRE------------TKWPSPAEYTP--L 173

  Fly  1268 RLDHAPAFSFGGKHDPKTE----HLHP------APCDYAPEKVRLDHTPAYTIAGRPAADHVSQT 1322
            .....||||||.:.....:    |..|      .||:|.|          .....:|:.:   :.
  Rat   174 SQPAFPAFSFGSRRRSSAKIPERHFRPGMLRARGPCNYTP----------LLATSKPSGE---KR 225

  Fly  1323 PAPCDYH--PEQCQVDST--PAFTFGMRLGRERISDTPA------PSAYEPEKHSLHSTPAYSFG 1377
            |.|..|:  | .|::.||  |||:         :|.:||      .|..:.||.:.....:::.|
  Rat   226 PGPNTYNIFP-GCRLQSTRSPAFS---------MSRSPAFASWVSSSKEDLEKEAWGWFGSWAAG 280

  Fly  1378 TKSDIRVTTDAPAPGHYHPEQCKLDSSPAYSFGLKTVPTASLP 1420
            ...|..|.|...                  |..|:..|...||
  Rat   281 EGKDAGVRTRVS------------------SLSLQPEPQVQLP 305



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21580
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.