DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and STPG3

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001243628.1 Gene:STPG3 / 441476 HGNCID:37285 Length:386 Species:Homo sapiens


Alignment Length:450 Identity:94/450 - (20%)
Similarity:140/450 - (31%) Gaps:164/450 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DSKKKAAPSYSFGHKLGGKYDTSG------PGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFS 127
            :|.:||....:..:..|||:.|.|      |.|.|             |:|:.|...|:....:.
Human     3 NSDQKAVKFLANFYINGGKHWTHGHLRQTQPEPTQ-------------PKASVLLLGPEPGMAWD 54

  Fly   128 NPGPGEYDVVPAAKAVIDATPK-----YT-------FGQRPVALKTFQIPGPNYYQVVPLDVVKR 180
            ...|.:...:|....:...||:     ||       ..|||:.....::|.|..|| ||...|:.
Human    55 ETQPPKMKEIPVGLRLQTGTPQESLPTYTQTLRELLLEQRPLITADLEVPSPTRYQ-VPSPSVRE 118

  Fly   181 RA--PRYSFRIKVNVYLVNNPAPNSYCPEKVTQSKKNAPRYT-----------FGRRTKIEHDQG 232
            .:  |.||...|                   .|.::...|..           |.::...:.:|.
Human   119 SSPHPHYSIGCK-------------------HQGREGGGRRAWQTLWFQSESPFTQKADFDQEQK 164

  Fly   233 TPAPGAYCPEKVKLNKTPEFSF-GIKHHEQRPD---YTPAPGTYKPEQVVLEHIPAYSFGLKTKH 293
            .|:|..|  :.:.....|.||| |.....:.|:   :...||             |...||:.:.
Human   165 WPSPAHY--QLLSRPAFPAFSFRGCHSASKTPEGHTHLGLPG-------------ARGLGLRVQP 214

  Fly   294 ---IQVSDTPAPGAYSP--------EKSRLHS--APAYSIAGKASQDVVDCTPAPGAYEPEKCVL 345
               :|.| ..|||...|        ..|||.|  :||:|                         :
Human   215 QSLLQAS-LQAPGKRCPGPNTYNILPGSRLQSPRSPAFS-------------------------M 253

  Fly   346 SRTPAFSFGHRAELAKSSDTPAPGTYNPEKVRLDHTPAFTLSGRPETRSVSETPAPGSYAPEKYR 410
            ||:|||:.......:..|..|.|.......::|. .|.....|.|   ..::|.||         
Human   254 SRSPAFTSWLSTSFSFGSPNPWPSRLPRGGLQLT-LPFGAWRGHP---GCTQTQAP--------- 305

  Fly   411 NDRTPAFTFGGKHEQRLESSTPAPGDYCPEKVRHDHN---PAFSFAGRHDLHKPSDTPAP 467
                       :|...|.:..||           .||   ||..:  .|.|  |...|.|
Human   306 -----------RHRPLLHALEPA-----------GHNLLGPATEW--NHGL--PRGFPRP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
STPG3NP_001243628.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..136 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21580
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.