DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and ODF3B

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001369737.1 Gene:ODF3B / 440836 HGNCID:34388 Length:261 Species:Homo sapiens


Alignment Length:251 Identity:75/251 - (29%)
Similarity:106/251 - (42%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGGNVEQRPWTPTVRIGKIAAETTNPGPATVQLPTLIGSKVPDSKKKAAPSYSFGHKLGGKYDTS 91
            ||.:.....|.|....|.|||....||| ..:||...|..:.|..:..||:::||.:...:..|.
Human     1 MGSDAWVGLWRPHRPRGPIAAHYGGPGP-KYKLPPNTGYALHDPSRPRAPAFTFGARFPTQQTTC 64

  Fly    92 GPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRP 156
            ||||.......|..:|.|...|.::..||:....|..||||.|....|..|...:.|::|...|.
Human    65 GPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRN 129

  Fly   157 VALKT-FQIPGPNYYQVV----PLDVVKRRAPR---YSFRIKVNVY--LVNNPAPNSYCPEKVTQ 211
            ..::. .|.|||..|.|.    |..:.|..||.   |..|...:.:  |...|.|.:|.......
Human   130 WGVQAEQQSPGPAAYTVPSLLGPRVIGKVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGV 194

  Fly   212 SKKNAPRYTFGRRTKIEHDQ-GTPAPGAYCPEKV------KLNKTPEFSFGIKHHE 260
            .|..||::|...||.:..|. ..|.|.||..::|      :..|...:||||:|.:
Human   195 YKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQVAWSPGSRHRKPRGWSFGIRHSD 250



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21580
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.