DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and CG10252

DIOPT Version :10

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_651171.1 Gene:CG10252 / 42794 FlyBaseID:FBgn0039104 Length:229 Species:Drosophila melanogaster


Alignment Length:55 Identity:15/55 - (27%)
Similarity:24/55 - (43%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 ATNRFEWDTVPVEARPEGGKLPPARILRKRH-QLESLVNEVMRLATDGAIIVDFC 416
            :||:..:|..|:..|....|....|....|: ::..:|:...|||...||....|
  Fly    24 STNKIPFDRCPIALRKMQHKTDEYRRQVNRYGKVPCIVDGSFRLAESVAIYRYLC 78

Return to query results.
Submit another query.