DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and CG10252

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_651171.1 Gene:CG10252 / 42794 FlyBaseID:FBgn0039104 Length:229 Species:Drosophila melanogaster


Alignment Length:234 Identity:70/234 - (29%)
Similarity:103/234 - (44%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IAAETTNPGPATVQLPTLIGSKVPDSKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGM----RA 105
            :|.....|||....||..:|....|::|:..|.||||.:.....:..||||..|.|..:    .:
  Fly     1 MAVRPFGPGPGVYMLPPTVGYDKHDNRKQRLPQYSFGMRTRAPGEDLGPGPGAYKVDKLTRYGTS 65

  Fly   106 KGRDY---PRAATLQSRPKELTRFSNPGPGEYDV--VPAAKAVIDATPKYTFGQRPVALKTFQI- 164
            ||.::   ||...:..|       |:||||.:||  .|..|.|  ..|.|:.|.|    ..|.. 
  Fly    66 KGLEFSMAPRTNVIDKR-------SSPGPGAHDVHNRPFFKGV--NAPSYSMGLR----TDFNFK 117

  Fly   165 ---PGPNYYQVVPLDVVKRRAPRYSFRIKVNVY-LVNNPAPNSYCPEKVTQSKKNAPRYTFGRRT 225
               ||||.|: ..::.|:...|.||..::..:. ..|:|.|.:|....:......||.|:...||
  Fly   118 KDGPGPNAYK-YEVNAVRPGVPSYSMGLQTKILNKTNSPGPAAYGGGDINVKLTRAPIYSMQPRT 181

  Fly   226 KIEHDQGTPAPGAYCPEKVKLNKT-PEFSFGIKHHEQRP 263
            .|..:...|.|..|.....:..|: |.:|||::||:..|
  Fly   182 TIPGENVGPGPNYYDLMYYRPGKSGPGYSFGVRHHQFAP 220



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100875
Panther 1 1.100 - - P PTHR21580
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.