DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Odf3l1

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001361610.1 Gene:Odf3l1 / 382075 MGIID:2681875 Length:306 Species:Mus musculus


Alignment Length:350 Identity:83/350 - (23%)
Similarity:123/350 - (35%) Gaps:93/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PRAATL-QSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPGPNYY---- 170
            |.|.|: ||:......|....|.:.:.||:         .:...|.||.:.|.:.|||..|    
Mouse    27 PLAFTMKQSKGSRNYVFYAQHPEKEEEVPS---------WHEIKQTPVIMATIKGPGPAKYLRSS 82

  Fly   171 --QVVPLDVVKRRAPRYSF---RIKVNVYLVNNPAPNSYCPEKVTQ-SKKNAPRYTFGRRTKIEH 229
              ..:..|:...:.|.||.   ..|..:..:|:|.|..:...|||: .....|:.....|.....
Mouse    83 CTGYIAHDISMFQEPAYSLHTRHTKKRIIDINSPGPCYFLNPKVTRFGISTCPQVPMEERISNPR 147

  Fly   230 DQGTPAPGAYCPEKVKLN---KTPEFSFGIKHHEQRPDYTPAPGTYKPEQVVLEHIPAYSFGLKT 291
            ....||...|..||.:.:   :.|:::||.:...:..|..|||..|:....:..:||.:      
Mouse   148 INCMPASCKYNLEKTRPSGERQPPQYTFGYRCPYRVMDPNPAPNQYQLPVTLGTNIPVF------ 206

  Fly   292 KHIQVSDTPAPGAYSPEKSRLHSAPAYSIAGKAS----QDVVDCTPAPGAY-EPEKCVL-SRTPA 350
                                 .:||:||:|....    ::.:...|.|..: .||..|. :|:|.
Mouse   207 ---------------------RAAPSYSLASTNKNWFHKENIAGGPGPAMHTRPEPSVYQNRSPL 250

  Fly   351 FSFGHRAELAKSSDTPAPGTYNPEKVRLDHTPAFTLSGRPETRSVSETPAPGSY--APEKYRNDR 413
            ||      :||....|           ||||               ..|.|||:  .|......|
Mouse   251 FS------MAKRFGCP-----------LDHT---------------HRPGPGSHDIQPVTVHKPR 283

  Fly   414 TPAFTFGGKHEQRLESSTPAPGDYC 438
            .||||.|.||...|   .|...|.|
Mouse   284 IPAFTMGIKHSPHL---CPLIVDIC 305



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.