DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Nup62

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001286489.1 Gene:Nup62 / 36830 FlyBaseID:FBgn0034118 Length:394 Species:Drosophila melanogaster


Alignment Length:307 Identity:71/307 - (23%)
Similarity:111/307 - (36%) Gaps:83/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1337 STPAFTFGMRLGRERISDTPAPSAYEPEKHSLHSTPA----YSFGTKSDIRVTTDAPAP----GH 1393
            :|.:|:||:..|      |||.:   |...:..:.||    :||||          |||    |.
  Fly    16 ATSSFSFGLSTG------TPAAA---PASGAATTAPATKTTFSFGT----------PAPTAGIGG 61

  Fly  1394 YHPEQCKLDSSPAYSFGLKTVPTASLPEPRGAYIEDRIVQRRERRLASPVRNNAECTTTTT---- 1454
            ...:..|..:.||:.|||.: .|||.|...|.           :..|:|....:...|.|:    
  Fly    62 GDADNSKAQAPPAFGFGLGS-GTASAPLTLGT-----------QAAANPASTTSATATGTSAAPP 114

  Fly  1455 ---NHTNNNAGSSTTTTTT----TTTTTKTFINGVEQPELQKKETTKQVNGTHKELKSAPQA--- 1509
               ..|...|.|...|..|    |..||...:.|   ..|...:||...:.|   |.:||.|   
  Fly   115 AFGGFTAQPAASVVPTIATSAPNTAATTTGLLGG---SGLGAPKTTAAASTT---LTAAPSAIAS 173

  Fly  1510 --------PLSNGNIVSN------GNHSKMVSTTTRIQEVAHGQKESGNLKVVASGKSDASATKA 1560
                    .||.|...:|      ...|..|||.:::.  .|..:|..|...:...:.:...|:.
  Fly   174 TQGAAPAPTLSTGGAFANLTTETKTTDSSAVSTASQLS--YHQLEEHINKWTLEFEEQEKVFTEQ 236

  Fly  1561 AAVSH---QTVVQADGAIVTSGQSSR-----MQTVKYAVEASSVQEK 1599
            |...:   :.::..:|.||....:.:     .|.:...:|..:.|:|
  Fly   237 ATQINAWDKLLISNNGKIVELNDAVKKVKTDQQVLDQELEFIATQQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Nup62NP_001286489.1 Nsp1_C 194..300 CDD:309972 16/92 (17%)
SMC_N <213..392 CDD:330553 12/71 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.