DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Odf3l2

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001178706.1 Gene:Odf3l2 / 299600 RGDID:1310260 Length:277 Species:Rattus norvegicus


Alignment Length:220 Identity:71/220 - (32%)
Similarity:109/220 - (49%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 PAPGAYEPEKCVLSRTPAFSFGHRAELAKSSD-TPAPGTY-NPEKVRLDHT--PAFTLSGRPETR 393
            |:...|....|..:.:||:|...|...|...| :|.|..: :|:..|...:  ||:::.||.:.|
  Rat    52 PSTVGYVNHDCTKAASPAYSLARRPSEAPLQDSSPGPVYFLDPKVTRFGRSCPPAYSMQGRGKIR 116

  Fly   394 SVSETPAPGSYAPEK---YRNDRTPAFTFGGKHEQR-LESSTPAPGDYCPEKVRHDH------NP 448
            .:..||.||:|:|||   .|....||||.|.:..|: .::|.|||..|....:....      :|
  Rat   117 GLEVTPGPGAYSPEKTPPIRQRNAPAFTLGSRLRQKPPDTSAPAPNAYTMPPLWGSQIFIKPSSP 181

  Fly   449 AFSFAGR----HDLHKPSDTPAPGAY---DTEKVRQDHNPAFSFAGRHDLHKPSE-TPAPGAYSP 505
            :::..||    .....||:||.||.|   |....|| ..||||..||....:|.| ||.||.::|
  Rat   182 SYTVVGRTPPARPPQDPSETPGPGQYESPDPNTYRQ-RRPAFSILGRPRTPRPPEDTPGPGTHNP 245

  Fly   506 EK--VRQDHNPAFSMAGKHSQKVTS 528
            |:  |.:...||::|..:||::.::
  Rat   246 EQVTVNRARAPAYTMGIRHSKRAST 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Odf3l2NP_001178706.1 PHA03247 <52..262 CDD:223021 69/210 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 1 1.000 - - otm44836
orthoMCL 1 0.900 - - OOG6_100875
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.