DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and ODF3L2

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_872383.1 Gene:ODF3L2 / 284451 HGNCID:26841 Length:289 Species:Homo sapiens


Alignment Length:239 Identity:76/239 - (31%)
Similarity:112/239 - (46%) Gaps:35/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 PAPGAYEPEKCVLSRTPAFSFGHRAELAKSSDTPAPGT---YNPEKVRLDH--TPAFTLSGRPET 392
            |:...:....|....:||:|...|...|...|| :||.   .:|:..|...  |||:::.||.::
Human    52 PSTVGFINHDCTRVASPAYSLVRRPSEAPPQDT-SPGPIYFLDPKVTRFGRSCTPAYSMQGRAKS 115

  Fly   393 RSVSETPAPGSYAPEK---YRNDRTPAFTFGGKHEQR-LESSTPAPGDYC------PEKVRHDHN 447
            |....||.||:|:|||   .|:...||||.|.:...: |::|.|||..|.      .:......:
Human   116 RGPEVTPGPGAYSPEKVPPVRHRTPPAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIFTKPSS 180

  Fly   448 PAFSFAGR----HDLHKPSDTPAPGAYDTEKVR--QDHNPAFSFAGRHDLHKP-SETPAPGAYSP 505
            |:::..||    .....|::.|.||.||:....  :...|||:..||....:| .|||.|||:.|
Human   181 PSYTVVGRTPPARPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCP 245

  Fly   506 EK--VRQDHNPAFSMAGKHSQK------VTSDSPA----PGDYC 537
            |:  |.:...|||||..:||::      .|...||    ||..|
Human   246 EQVTVNKARAPAFSMGIRHSKRASTMAATTPSRPAGHRLPGRCC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
ODF3L2NP_872383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..136 11/27 (41%)
STPGR 1 122..148 13/25 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..211 9/29 (31%)
STPGR 2 202..227 8/24 (33%)
STPGR 3 238..263 12/24 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..289 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100875
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.