DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and Nup62cl

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001075137.1 Gene:Nup62cl / 279706 MGIID:2685565 Length:272 Species:Mus musculus


Alignment Length:119 Identity:27/119 - (22%)
Similarity:38/119 - (31%) Gaps:46/119 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1439 LASPVRNNAECTTTTTNHTNNNAGSSTTTTTTTTTTTKTF------------------------- 1478
            :||...::...|||||          |.||.||||.|..|                         
Mouse    12 MASQELSSTTSTTTTT----------TVTTNTTTTITSGFNLYVRPPASPWLNNTGLINVASMPS 66

  Fly  1479 ---INGVEQPELQKKETTKQVNGTHKELK--------SAPQAPLSNGNIVSNGN 1521
               :|.:..|.:.........|..|.:|:        .|.|..|.|..::.:||
Mouse    67 TMTVNSIVTPVMTYGPLESMANNWHYQLQEQEKHYFYQANQFNLWNQALIESGN 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
Nup62clNP_001075137.1 Nsp1_C 65..179 CDD:368271 11/56 (20%)
SMC_prok_B <105..>266 CDD:274008 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.