DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and CG31468

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:NP_001262879.1 Gene:CG31468 / 251937 FlyBaseID:FBgn0047351 Length:80 Species:Drosophila melanogaster


Alignment Length:88 Identity:23/88 - (26%)
Similarity:35/88 - (39%) Gaps:23/88 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGPATVQLPTLIGSKVPDSKKKAAPSYSFGHK---LGGKYDTSGPGPAQYNVTGMRAKGRDYPRA 113
            |||....||:..|.|..|.:.:.:|.:|||..   ........|||||.|:|             
  Fly     9 PGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIPQGPGPADYHV------------- 60

  Fly   114 ATLQSRPKELTRFSNPGPGEYDV 136
                   .::||:..|...:::|
  Fly    61 -------GKITRYGRPASEDFNV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8086NP_001260237.1 None
CG31468NP_001262879.1 SHIPPO-rpt 8..42 CDD:254017 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.