DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and ODF3L1

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:XP_006720477.1 Gene:ODF3L1 / 161753 HGNCID:28735 Length:291 Species:Homo sapiens


Alignment Length:301 Identity:76/301 - (25%)
Similarity:115/301 - (38%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PINMGGNVEQRPWTPTVRIGKIAAETTNPGPATVQLPTLIG-----------------SKVPDSK 71
            |:.....|:|.|        .|.|:...||||....|:..|                 |:..:.:
Human    21 PLPSRQEVKQTP--------VIMAKIKGPGPAKYLRPSCTGYIDHDISMFKAPAYTLHSRHSEKR 77

  Fly    72 KKAAPSY--SFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEY 134
            ::..||:  ..|..:||....|.|||. |.:.                  || :|||   |....
Human    78 ERCHPSHPAGVGAVVGGMVCHSSPGPC-YLLD------------------PK-ITRF---GMSSC 119

  Fly   135 DVVPAAKAVIDATPKYTFGQRPVALKTFQIPGPNYYQVVPLDVVKRRAPRYSFRIKVNVYLVN-N 198
            ..||..:.:.:.....|........:....||            :||||:|:|..:....::: |
Human   120 PQVPMEERISNLRLNPTLASCQYYFEKIHPPG------------ERRAPQYTFGYRRPYRVMDLN 172

  Fly   199 PAPNSYCPEKV----TQSKKNAPRYTFGRRTK----IEHDQGTPAPGAYC-PE-KVKLNKTPEFS 253
            ||||.|....:    |...:.||.|:...|.|    .|...|.|.|..|. || .:..|::|.:|
Human   173 PAPNQYQMPLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYS 237

  Fly   254 FGIKHHEQRPDYT--PAPGTYKPEQVVLE--HIPAYSFGLK 290
            .. |......|.|  |.||:::.:||.:.  ||||::.|:|
Human   238 MA-KRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIK 277



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.