DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8086 and odf3l1

DIOPT Version :9

Sequence 1:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster
Sequence 2:XP_017952625.2 Gene:odf3l1 / 100487571 XenbaseID:XB-GENE-6037717 Length:253 Species:Xenopus tropicalis


Alignment Length:234 Identity:83/234 - (35%)
Similarity:107/234 - (45%) Gaps:39/234 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 PAPGDYH-PEK---VRQDH----NPAYSFAGR--HDLQKPDNTPAPGAYFPEKV-RLDHN--PAF 615
            |.||.|: |..   |..|:    :|||||.||  :.....|::|.|..|....: |...:  |::
 Frog    19 PGPGRYNLPPTVGFVSHDYTKFSSPAYSFHGRPSNSAHVSDSSPGPRYYVDASLTRFGRSAGPSY 83

  Fly   616 SMAGK-YDAKVTNDTPAPGDYSPEKVRQDTN---PAYSFAGRHDLHKPSETPAPGAYS------P 670
            ||..: ..|...||.|.||.|||||....|.   |:||...|.........|||.:||      |
 Frog    84 SMLARGRSADKKNDIPGPGTYSPEKCTVPTQRKFPSYSMGSRTRYRSMDRVPAPNSYSLPPVLGP 148

  Fly   671 EKVRLDHNPAFTMAGKHD----QKILNGTPAPGDY---SPEKCRLDHTPAYSFGGKN-DPKVENN 727
            ........||||::||:.    .:.|:|||.|..|   .|.: .|...||:|..|:. :.|.|..
 Frog   149 RATAKVCAPAFTLSGKYQHGGHSEDLSGTPGPAHYQQTDPSR-YLKRGPAFSMQGRQPNSKAEQK 212

  Fly   728 TPAPGDYHPEKVRLD--HNPAYSFAGRHDLQKPSDTPAP 764
            ||.||.|:||||...  |.||||...||     |:..||
 Frog   213 TPGPGSYYPEKVNQHKRHAPAYSMGIRH-----SEYTAP 246



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532520at33208
OrthoFinder 1 1.000 - - FOG0001087
OrthoInspector 1 1.000 - - otm47880
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5363
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.