Sequence 1: | NP_001162911.1 | Gene: | Pvr / 34127 | FlyBaseID: | FBgn0032006 | Length: | 1577 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_201529.1 | Gene: | RLK / 836863 | AraportID: | AT5G67280 | Length: | 751 | Species: | Arabidopsis thaliana |
Alignment Length: | 329 | Identity: | 73/329 - (22%) |
---|---|---|---|
Similarity: | 113/329 - (34%) | Gaps: | 94/329 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1087 NEPHNNNTQPPTHRRNSDNDPRSGTRA---------------------GRTGS----------GT 1120
Fly 1121 AT-------YSYDRQMDTCATVMTTVP---------------EDDQI-----MSNNSVQPAWRSN 1158
Fly 1159 YKTDSTEAMTVTTVDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFGLARSMY 1223
Fly 1224 RGDNY-----------KKS----ENGKLP--------IKWLALESLSDHVFSTYSDVWSYGIVLW 1265
Fly 1266 EMFS--------LAKVPYPGIDPNQELFNKLNDGYR--MEKPKFANQELYEIMLECWRKNPESRP 1320
Fly 1321 LFAE 1324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pvr | NP_001162911.1 | IG | 346..432 | CDD:214652 | |
Ig | <363..432 | CDD:299845 | |||
Ig | 466..533 | CDD:299845 | |||
IG_like | 672..754 | CDD:214653 | |||
Ig | 674..739 | CDD:143165 | |||
IGc2 | 779..840 | CDD:197706 | |||
PKc_like | 927..1332 | CDD:304357 | 73/329 (22%) | ||
Pkinase_Tyr | 935..1329 | CDD:285015 | 73/329 (22%) | ||
RLK | NP_201529.1 | LRRNT_2 | 31..72 | CDD:400522 | |
PLN00113 | <74..742 | CDD:215061 | 73/329 (22%) | ||
leucine-rich repeat | 79..101 | CDD:275380 | |||
leucine-rich repeat | 102..125 | CDD:275380 | |||
leucine-rich repeat | 126..149 | CDD:275380 | |||
leucine-rich repeat | 150..173 | CDD:275380 | |||
leucine-rich repeat | 174..195 | CDD:275380 | |||
leucine-rich repeat | 196..217 | CDD:275380 | |||
leucine-rich repeat | 218..242 | CDD:275380 | |||
PKc_like | 458..744 | CDD:419665 | 66/282 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |