DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and Ceacam20

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:XP_006540423.1 Gene:Ceacam20 / 71601 MGIID:1918851 Length:579 Species:Mus musculus


Alignment Length:427 Identity:96/427 - (22%)
Similarity:165/427 - (38%) Gaps:90/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 SENNFKILSTEL-----STMLQVLNAQLQDSGTYVLRGSNSFGVVQREYNVSVM-----DAPALK 540
            |.|:..:|:..:     :..|.:|..|.:|||:|:....:.| .|||....|:.     |..::|
Mouse    85 SNNSLLVLNERMKLSADNKTLTILIVQREDSGSYLCEVQHGF-EVQRSNTASLTVNYGPDPVSIK 148

  Fly   541 MSDAY-------VQVGSVARLECTVRSYP-PAIVTFFFRPCSLEPQWPTCSVLNQNFSLPSEQEK 597
            :....       |..|:........:|.| ||...:                      |||:   
Mouse   149 LDSGVAAGDVVEVMEGNTVNFRVEAQSSPVPAYAWY----------------------LPSD--- 188

  Fly   598 YQFQTRPRPGKLSVERIYEVSFLPTEPGILTCIAQNIIDGKERRTLTKAHVLLGNISENMTIYGF 662
              |...|..|..:::.:..     ...|:..|:..|.:....|..:.|..||....:.|:.   |
Mouse   189 --FIQPPTTGTFTIDAVSR-----EHEGMYRCLVSNPVTNLSRLGVVKVQVLEKVTAPNIE---F 243

  Fly   663 DKDHKIAKEDNVNFTCEALAYHFDGNLKWFINGEDLKESDSVHIETSHTKYSYKSTVHITTISDR 727
            .....:....:|..||:  ..|....:.||:.|:.|:.||.:      |..|...|:.|..:...
Mouse   244 PTLALVENATSVTLTCK--TSHQRVGVHWFLKGQPLRPSDRL------TLSSQNRTLTIHGLQRD 300

  Fly   728 DRGTYECRAYHNDKDAVYSSREIDLYV---HDPSAPQWTNGGQEG-HSKIKRKLSQTLELECAST 788
            |.|.|||..::....|    |.:.|.:   :.|...:.|.|...| .|.|:..|:.:|.|.|.:.
Mouse   301 DIGPYECEVWNWGSQA----RSVPLKLTINYGPDQVEITQGPASGVVSTIEAMLNSSLTLYCRAD 361

  Fly   789 AVPVAIVRWFKDDKEVTESKLRHIIEKESKLLITHLYPGDEGVYKCVVENRLDRIERSFTVVI-- 851
            ::|.|..:|       |......:::.| :|.|..|....:|:|.|...|.:..:.||.:|::  
Mouse   362 SIPGARYQW-------THEHSSKVLDGE-QLSIEALRQEHQGIYSCTSSNDVTGLARSASVLVMV 418

  Fly   852 --------SDLPGISMAWVWFGVILFLIL-IGLCVFL 879
                    |..|| ::|.:..|:::.:.| |||..||
Mouse   419 VGRGLQSSSMSPG-AIAGIVIGILVAIALAIGLGYFL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845 14/51 (27%)
IG_like 672..754 CDD:214653 22/81 (27%)
Ig 674..739 CDD:143165 19/64 (30%)
IGc2 779..840 CDD:197706 15/60 (25%)
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
Ceacam20XP_006540423.1 Ig 63..139 CDD:386229 15/54 (28%)
Ig_3 160..217 CDD:372822 14/88 (16%)
Ig 234..326 CDD:386229 24/106 (23%)
IG_like 344..416 CDD:214653 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.