DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and pdgfrl

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_956608.2 Gene:pdgfrl / 393284 ZFINID:ZDB-GENE-040426-901 Length:371 Species:Danio rerio


Alignment Length:188 Identity:46/188 - (24%)
Similarity:70/188 - (37%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SSIYVYVNDPDTKLVDS---HNVVTARQYTDVVIPCKPAMPDTEVLL--ETSNGEMHSSKSVGRY 206
            |:.|:|..|.|...|.|   ..::..|......|||:...|..:|.|  |....|:....:...|
Zfish   155 SATYIYFTDKDELFVPSAIHFEIIYLRPDKPATIPCRVTNPKIKVSLHREVPAEEIAVDGTQISY 219

  Fly   207 DPQRGFTIEIRSIVDGGDYYCRPNPPFPHNEEEMTSIEVRFIATGLDIPRTQTTNMVYTYAPGVT 271
            :|.:||.|:..|....|.|||:.|.......:..|..::.::    ::|.......:...:..|:
Zfish   220 NPTKGFIIQNPSPEHKGAYYCKANSTSKTTPQISTKYQLLYV----EVPSGPPFATIEASSNSVS 280

  Fly   272 DGDDEVLTVTNQSTGNLALIRGGDGTLSRERARRSPARLAPMNASPSPR-PGQDGKPL 328
            .||  |..||....|.                       ..||.|.|.| ||||.:|:
Zfish   281 GGD--VFNVTCTVLGE-----------------------PEMNVSFSWRYPGQDQRPV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
pdgfrlNP_956608.2 IG_like 178..249 CDD:214653 20/70 (29%)
Ig 186..249 CDD:143165 19/62 (31%)
Ig 287..356 CDD:299845 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11782
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.