DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and drpr

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:288 Identity:50/288 - (17%)
Similarity:87/288 - (30%) Gaps:102/288 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1218 LARSMYRGDNYKKSENGKLPIKWLALESLSDHVFSTYSDVWSYGIVLWEMFS------------- 1269
            :.||.|.|||..         :.:|.:.::|...::.....:..:||..:|:             
  Fly   770 VCRSGYTGDNCD---------ELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRR 825

  Fly  1270 -------LAKVPY------PGIDPNQELFNKLNDGYRMEKPKFANQELYEIMLECWRKNPESRPL 1321
                   :|.|.|      |...||          :..:.|.:..|             .|:|.|
  Fly   826 VSNLKTEIAHVHYTHDTNPPSWPPN----------HNFDNPVYGMQ-------------AETRLL 867

  Fly  1322 FAELEKRFANM---------LGED------VASHYLDLNNPYMQSNIEYMKKQSTDYLALMGSPD 1371
            ...:..:..|.         .|:|      |.|:.::.|:..:..|:               :.|
  Fly   868 PNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNL---------------NAD 917

  Fly  1372 ELAPAAPRYVNGHIV--PDIRIEELPDDYMEMSRDSDPDACTAIFSPTRLEGESSDFPDFSSETT 1434
            ...|         ||  ..::.|.:.|:........||   ..|:|......:..|..|:|..:|
  Fly   918 RTNP---------IVYNESLKEEHVYDEIKHKEGYKDP---VKIYSKILFPEDEYDHLDYSRPST 970

  Fly  1435 FNFPGARQSPTLSNNLNSGSSKPLRKKN 1462
            ...|...:......|:|....||...||
  Fly   971 SQKPHYHRMNDAMLNINQDEEKPSNVKN 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357 22/139 (16%)
Pkinase_Tyr 935..1329 CDD:285015 22/136 (16%)
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.