DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and Drl-2

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:168 Identity:61/168 - (36%)
Similarity:98/168 - (58%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1159 YKTDSTEAMT-VTTVDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFGLARSM 1222
            |...|.|:.| ::|..|:.:...:.:|:.||.|..::|.|:|.||..|.|::.|||||..|:|.:
  Fly   467 YLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDL 531

  Fly  1223 YRGDNYKKSENGKLPIKWLALESLSDHVFSTYSDVWSYGIVLWEMFSLAKVPYPGIDPNQELFNK 1287
            :..|.....:|...|:|||:||||...|::|..|||:.|:..||:.:||::|:..:| ..||.|.
  Fly   532 FPDDYDCLGDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVD-IFELTNY 595

  Fly  1288 LNDGYRMEKPKFANQELYEIMLECWRKNPESRPLFAEL 1325
            |..|:|:|:|.....|.:.:|..||....:.||..::|
  Fly   596 LAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357 61/168 (36%)
Pkinase_Tyr 935..1329 CDD:285015 61/168 (36%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 61/168 (36%)
STYKc 389..637 CDD:214568 61/168 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.