DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and styk1b

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_001292494.1 Gene:styk1b / 324714 ZFINID:ZDB-GENE-030131-3435 Length:447 Species:Danio rerio


Alignment Length:244 Identity:71/244 - (29%)
Similarity:112/244 - (45%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1133 ATVMTTVPEDDQIMSNNSVQP-AWRSNYKTDSTEAM-TVTTVDLISWAFQVARGMDYLSSKKVLH 1195
            |.::|.:.|    |.|..:.. .||........:.| .:|...:.:.|..||..:|:|..|.:.|
Zfish   217 APLITVIEE----MENRDLLGFLWRCRQDNVGPDGMCQMTEKKIFNMASHVASALDFLHGKDLHH 277

  Fly  1196 GDLAARNILLCEDNVVKICD---FGL----ARSMYRGDNYKKSENGKLPIKWLALESLSDHVFST 1253
            .:|.|||:|     |.:||.   :||    .|:...| ||.:....|   ||.|.|.|:....:.
Zfish   278 CNLKARNVL-----VSRICTAKLWGLDDLYVRTSGSG-NYSEDPGRK---KWQAPELLAKRPSTP 333

  Fly  1254 YSDVWSYGIVLWEMFSLAKVPYPGIDPNQELFNKLNDGYRMEKPKFANQELYEIMLECWRKNPES 1318
            .||:||:|::|:||.:|.:||:..| |.:||.........:.||...:..||.|:..|.....:.
Zfish   334 KSDIWSFGLLLYEMVTLGEVPFAEI-PVKELLQHHQRVKPIRKPNNCSNSLYSIIKSCCHWKEQD 397

  Fly  1319 RPLFAELEKRFANMLGEDVASHYLDLNNPYMQSNIEYMKK----QSTDY 1363
            ||..||:.::..:  ||..||....|..|...:..:|:|:    :|..|
Zfish   398 RPSLAEVRRKLQS--GEKSASDSSVLRVPEPINIQQYLKEAGYGESNSY 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357 61/207 (29%)
Pkinase_Tyr 935..1329 CDD:285015 61/204 (30%)
styk1bNP_001292494.1 PKc_like 164..409 CDD:304357 61/205 (30%)
Pkinase_Tyr 164..408 CDD:285015 61/204 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.