DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and fgfr1a

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:XP_009302578.1 Gene:fgfr1a / 30705 ZFINID:ZDB-GENE-980526-255 Length:811 Species:Danio rerio


Alignment Length:840 Identity:226/840 - (26%)
Similarity:341/840 - (40%) Gaps:254/840 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 TRPRPGKLSVERIYEVSFLPTEPGILTCIAQNIIDGKERRTLTKAHVLLGNIS---ENMTIYGFD 663
            ||.|..::.:|::.     ||:.|:..|.||.         |...|....|||   |...:....
Zfish    77 TRLRNDQMEIEKVE-----PTDSGLYACFAQG---------LNSNHTEYFNISVTDEEDEVDSSS 127

  Fly   664 KDHKIAKEDN-------------------------VNFTCEALAYHFDGN----LKWFINGEDLK 699
            ::.|::.:.|                         |.|.|:|     :||    |||..||::.|
Zfish   128 EEAKLSNDQNLPMAPVWAQPDKMEKKLHAVPASKTVKFRCQA-----NGNPTPTLKWLKNGKEFK 187

  Fly   700 ESDSVHIETSHTKYSYKSTVHITTI-----SDRDRGTYECRAYHNDKDAVYSSREIDLYVHDPSA 759
            ....:.        .:|...|:.||     ...|||.|.| ...|...::..:.::|:....|..
Zfish   188 RDQRIG--------GFKVREHMWTIIMESVVPSDRGNYTC-LVENRHGSINHTYQLDVVERSPHR 243

  Fly   760 PQWTNGGQEGHSKIKRKLSQTLELECASTAVPVAIVRWFKDDKEVTESK-----------LRHII 813
            |....|.....:.:   :...:|.||...:.|...::|.| ..||..|:           |::..
Zfish   244 PILQAGLPANRTAV---VGSDVEFECKVFSDPQPHIQWLK-HIEVNGSRYGPDGLPYVRALKNSG 304

  Fly   814 EKESKLLITHLYPGDE---GVYKCVVENRLDRIERS--FTVV-------ISDLPG---ISMAWVW 863
            ...|...:..||...|   |.|.|.|.|.:.:..:|  .|||       .:.||.   :.:....
Zfish   305 VNSSDTQVLTLYNVTEEQSGEYICKVSNYIGQANQSAWLTVVKHLQAVPPTQLPNQTYLEVLIYC 369

  Fly   864 FGVILFLILIGLCVF---------------LAVRYQKEHK--------RHLALKAAGLANFEEGA 905
            .|..|..:::|..|.               |||     ||        |.:.:.....::...|.
Zfish   370 VGFFLICVMVGTAVLAKMHSSAKKSDFNSQLAV-----HKLAKSIPLRRQVTVSVDSSSSMHSGG 429

  Fly   906 VGHINPDLTLDEQAELLPYNREFEFP--------RENLKLGKQLGAGAFGVVLKGEAKGIRREEP 962
            : .:.|.......:.:|....|:|.|        |:.|.|||.||.|.||.|:..||.|:.:|:|
Zfish   430 M-LVRPSRLSSSGSPMLSGVSEYELPQDPRWEVQRDRLVLGKPLGEGCFGQVMMAEAMGMDKEKP 493

  Fly   963 T--TTVAVKMVKATADNEVVRALVSELKIMVHLGQHLNVVNLLGAVTKNIAKRELMVIVEYCRFG 1025
            .  |.|||||:|:.|..:.:..|:||:::|..:|:|.|::|||||.|::   ..|.||||:...|
Zfish   494 NRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQD---GPLYVIVEFAAKG 555

  Fly  1026 NIQNFLLRNRKCFINQINPDTDHIDPSIMTQRMSDNYELHRDTNGGGLKYANVGFPIHSYINEPH 1090
            |::.:|...|                                                       
Zfish   556 NLREYLRVRR------------------------------------------------------- 565

  Fly  1091 NNNTQPPTHRRNSDNDPRSGTRAGRTGSGTATYSYDRQMDTCATVMTTVPEDDQIMSNNSVQPAW 1155
                 ||                              .|:.|                       
Zfish   566 -----PP------------------------------GMEYC----------------------- 572

  Fly  1156 RSNYKTDSTEAMTVTTVDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFGLAR 1220
               |..|......::..||:|.|:||||||:||:|||.:|.||||||:|:.||||:||.||||||
Zfish   573 ---YNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLAR 634

  Fly  1221 SMYRGDNYKKSENGKLPIKWLALESLSDHVFSTYSDVWSYGIVLWEMFSLAKVPYPGIDPNQELF 1285
            .::..|.|||:.||:||:||:|.|:|.|.:::..|||||:|::|||:|:|...||||: |.:|||
Zfish   635 DIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGV-PVEELF 698

  Fly  1286 NKLNDGYRMEKPKFANQELYEIMLECWRKNPESRPLFAELEKRFANMLGEDVASHYLDLN 1345
            ..|.:|:||::|.....|||.:|.:||...|..||.|.:|.:.....|.......||||:
Zfish   699 KLLKEGHRMDRPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRTLSMTSNQEYLDLS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652
Ig <363..432 CDD:299845
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653 24/115 (21%)
Ig 674..739 CDD:143165 21/73 (29%)
IGc2 779..840 CDD:197706 19/74 (26%)
PKc_like 927..1332 CDD:304357 139/414 (34%)
Pkinase_Tyr 935..1329 CDD:285015 135/395 (34%)
fgfr1aXP_009302578.1 Ig 28..116 CDD:416386 14/52 (27%)
Ig strand A 28..31 CDD:409353
Ig strand A' 38..44 CDD:409353
Ig strand B 47..57 CDD:409353
Ig strand C 61..66 CDD:409353
Ig strand C' 69..71 CDD:409353
Ig strand D 76..80 CDD:409353 2/2 (100%)
Ig strand E 83..88 CDD:409353 0/4 (0%)
Ig strand F 94..103 CDD:409353 3/8 (38%)
Ig strand G 106..116 CDD:409353 3/9 (33%)
Ig 142..236 CDD:416386 22/107 (21%)
Ig strand A 142..145 CDD:409353 0/2 (0%)
Ig strand A' 153..158 CDD:409353 0/4 (0%)
Ig strand B 162..170 CDD:409353 4/12 (33%)
Ig strand C 176..181 CDD:409353 3/4 (75%)
Ig strand C' 184..186 CDD:409353 0/1 (0%)
Ig strand D 195..198 CDD:409353 1/2 (50%)
Ig strand E 202..207 CDD:409353 2/4 (50%)
Ig strand F 216..223 CDD:409353 2/7 (29%)
Ig strand G 226..236 CDD:409353 0/9 (0%)
Ig 244..345 CDD:416386 22/104 (21%)
Ig strand A 244..247 CDD:409353 1/2 (50%)
Ig strand A' 251..255 CDD:409353 0/3 (0%)
Ig strand B 263..270 CDD:409353 3/6 (50%)
Ig strand C 274..281 CDD:409353 2/7 (29%)
Ig strand D 296..301 CDD:409353 0/4 (0%)
Ig strand E 311..316 CDD:409353 0/4 (0%)
Ig strand F 324..332 CDD:409353 4/7 (57%)
Ig strand G 335..343 CDD:409353 1/7 (14%)
FGFR3_TM 358..387 CDD:407957 5/28 (18%)
PTKc_FGFR1 452..753 CDD:270678 139/420 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.