DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and Ceacam20

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_001163795.1 Gene:Ceacam20 / 292701 RGDID:1311281 Length:579 Species:Rattus norvegicus


Alignment Length:506 Identity:109/506 - (21%)
Similarity:191/506 - (37%) Gaps:127/506 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 TDN----SNQNVQRA-------TYRIKVLKQNESYLNVGEPSGHYNVQEYANRTIQMTANFEGFP 469
            ||:    ||..::||       |.|.:|:.:..      :.:..|......|.||....|     
  Rat    33 TDHAELLSNTQMERASLAKPILTVRQRVVTEQR------DMADFYCATNAVNATIHWVFN----- 86

  Fly   470 TPSFSWFKPDGTEVRQSENNFKILSTEL-----STMLQVLNAQLQDSGTYVLRGSNSFGVVQREY 529
                              |:..:|:..:     :..|.||..|.:|||:|:....:.|.|.:.:.
  Rat    87 ------------------NSLLVLNERMKLSADNKNLTVLVVQREDSGSYLCEVQSGFEVGRSDD 133

  Fly   530 NVSVM----DAPALKMSDAYVQVGSVARLE--------CTVRSYPPAIVTFFFRPCSLEPQWPTC 582
            .:..:    |..::|: |:.|..|.|..:.        ...:|||....|::.         ||.
  Rat   134 TLLEVNYGPDPVSIKL-DSGVATGDVVEVMEGNTVNFWVETQSYPAPTYTWYL---------PTD 188

  Fly   583 SVLNQNFSLPSEQEKYQFQTRPRPGKLSVERIYEVSFLPTEPGILTCIAQNIIDGKERRTLTKAH 647
            |:                |..|..|:|::..|..     .:.|:..|:..|.:....|..:.|..
  Rat   189 SI----------------QPPPITGQLTIPAISR-----EQEGMYRCLVSNTVTNSSRLGVVKVQ 232

  Fly   648 VLLGNISENMTIYGFDKDHKIAKEDN---VNFTCEALAYHFDGNLKWFINGEDLKESDSVHIETS 709
            ||     |.:|. .:.:...:|..:|   |..||:  ..|....:.|::.|:.|..|:  |:..|
  Rat   233 VL-----EKVTA-PYIESPTLALVENATSVMLTCK--TSHQRVGVHWYLRGQPLMPSE--HLTLS 287

  Fly   710 HTKYSYKSTVHITTISDRDRGTYECRAYHNDKDAVYSSREIDLYV-HDPSAPQWTNGGQEG-HSK 772
                |...|:.|..:...|.|.|||..::....|  .|..::|.: :.|.....|.|...| .:.
  Rat   288 ----SQNRTLTIHGLQRDDSGPYECEVWNWGSQA--RSVPLELTINYGPDQVDITQGSASGVVNT 346

  Fly   773 IKRKLSQTLELECASTAVPVAIVRWFKDDKEVTESKLRHIIEKESKLLITHLYPGDEGVYKCVVE 837
            |:..|:.:|.|.|.:.:.|.|...|       |......:...: :|.|..|....:|:|.|...
  Rat   347 IEATLNSSLTLHCWADSKPGARYHW-------THEHSSQVFAGD-QLNIEALRQEHQGIYSCTSS 403

  Fly   838 NRLDRIERSFTVVI--------SDLPGISMAWVWFGVILFL-ILIGLCVFL 879
            |.:..:.||.:|::        |..||: :|.:..|::..: ::|||..||
  Rat   404 NNVTGLTRSASVLVTVVGLQSSSMSPGV-IAGIVIGILAAIALVIGLGYFL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652 8/26 (31%)
Ig <363..432 CDD:299845 8/26 (31%)
Ig 466..533 CDD:299845 12/71 (17%)
IG_like 672..754 CDD:214653 22/84 (26%)
Ig 674..739 CDD:143165 18/64 (28%)
IGc2 779..840 CDD:197706 14/60 (23%)
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
Ceacam20NP_001163795.1 Ig 63..139 CDD:299845 17/104 (16%)
IG_like 158..233 CDD:214653 18/104 (17%)
IGc2 163..218 CDD:197706 14/84 (17%)
Ig 250..327 CDD:299845 22/86 (26%)
IG_like 255..326 CDD:214653 21/80 (26%)
IG_like 346..417 CDD:214653 19/78 (24%)
IGc2 352..406 CDD:197706 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.