DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and Pdgfrl

DIOPT Version :10

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_001011921.1 Gene:Pdgfrl / 290771 RGDID:1308028 Length:375 Species:Rattus norvegicus


Alignment Length:445 Identity:86/445 - (19%)
Similarity:139/445 - (31%) Gaps:171/445 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GENG-APLMTPCKSAI--ILDAQTSTTLKCEDDEPMSWWTSQSQYVHVKSFDN--TEDPARPF-- 99
            |||. .|.....|..|  |.|..|:      |..|      :||.:.:::.||  .:.||...  
  Rat    34 GENRIKPTNKKAKPKIPKIKDRDTA------DSAP------KSQSIMMQAMDNGRFQKPAATVSL 86

  Fly   100 --GTSLHL----IEVTADYVAAYYCVKTSKFSQIAKEEQSDEAMIELVN---------------- 142
              |.|:.|    .:|...| .||  :.|.|.|::..::......:.|||                
  Rat    87 MAGQSVELRCKGSKVEWSY-PAY--LDTFKDSRLTVKQNERYGQLTLVNSTTADTGEFSCWERLC 148

  Fly   143 QGY--------ASSIYVYVNDPDTKLVDS---HNVVTARQYTDVVIPCKPAMPDTEVLL--ETSN 194
            .||        ..|.|::..:.....|.|   .:||........|:||:...|..:|.|  |...
  Rat   149 NGYICRRDEARTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTAPSAKVTLHREFPA 213

  Fly   195 GEMHSSKSVGRYDPQRGFTIEIRSIVDGGDYYCRPNPPFPHNEEE-----------MTSIEVRFI 248
            .|:.::.:...||.:|||.            |.:     ||::.:           .:.|.|::.
  Rat   214 KEIPANGTDIVYDMKRGFV------------YLQ-----PHSDHQGVVYCKAEAGGKSQISVKYQ 261

  Fly   249 ATGLDIPRTQTTNMVYTYAPGVTDGDDEVLTVTNQSTGNLALIRGGDGTLSRERARRSPARLAPM 313
            ...:::|         :..|..|     :|..:|:       :||||                  
  Rat   262 LLYVEVP---------SGPPSTT-----ILASSNK-------VRGGD------------------ 287

  Fly   314 NASPSPRPGQDGKPLPKPVIRSSVEHHVFTDTNFTLDC----EQSAYVESVYGMEWFTPSRDENR 374
                                            :.::.|    |....||    ..|..|.:.:.|
  Rat   288 --------------------------------DISVLCTVLGEPDVEVE----FRWIFPGQKDER 316

  Fly   375 IFASQSRTDPKTRNSTHQT--GRSTLTVLNAQPSDTGLYKCVTTDNSNQNVQRAT 427
            ....|.......|...|.|  .:|.:||.:.:..|.|.|.|..     ||::..|
  Rat   317 PVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTA-----QNLRGQT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG_like 346..432 CDD:214653 21/88 (24%)
Ig strand C 363..366 CDD:409353 0/2 (0%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 425..428 CDD:409353 1/3 (33%)
Ig 458..533 CDD:472250
Ig strand B 459..463 CDD:409353
Ig strand C 472..476 CDD:409353
Ig strand E 497..503 CDD:409353
Ig strand F 513..518 CDD:409353
Ig 671..>742 CDD:472250
Ig strand B 674..678 CDD:409353
Ig strand C 687..691 CDD:409353
Ig strand E 717..721 CDD:409353
Ig strand F 731..736 CDD:409353
Ig 779..851 CDD:472250
Ig strand B 781..785 CDD:409570
Ig strand C 794..798 CDD:409570
Ig strand E 816..821 CDD:409570
Ig strand F 831..836 CDD:409570
Ig strand G 844..847 CDD:409570
Protein Kinases, catalytic domain 927..1332 CDD:473864
PdgfrlNP_001011921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..63 11/40 (28%)
IG_like 83..>143 CDD:214653 13/62 (21%)
Ig 278..372 CDD:472250 26/155 (17%)
Ig strand B 289..293 CDD:409353 0/3 (0%)
Ig strand C 304..308 CDD:409353 1/7 (14%)
Ig strand E 340..344 CDD:409353 1/3 (33%)
Ig strand F 354..359 CDD:409353 2/4 (50%)
Ig strand G 367..370 CDD:409353 86/445 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.