DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and FGFR4

DIOPT Version :10

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:NP_002002.3 Gene:FGFR4 / 2264 HGNCID:3691 Length:802 Species:Homo sapiens


Alignment Length:116 Identity:24/116 - (20%)
Similarity:46/116 - (39%) Gaps:41/116 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SLYKLYRMDEMKAGRLVGEDKYGN--------KYYEDPSQFYGRNRWVEYAPHWNLE-YDGSQ-- 79
            :|.:|.|:|::..      |..||        |||.           :....|:::: .:|::  
Human   233 ALAQLRRVDQLTI------DPQGNPVVNFTLWKYYV-----------LFRLSHFSMQKINGTEVT 280

  Fly    80 ----IPAE-WFGWMHY--KTDLPPNR------DGNRPHYAWMLDHSDNKSG 117
                |.|| .||.:.:  .::||..|      |..:..:.::|:....|.|
Human   281 QNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKPG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG_like 346..432 CDD:214653
Ig strand C 363..366 CDD:409353
Ig strand E 396..400 CDD:409353
Ig strand F 410..415 CDD:409353
Ig strand G 425..428 CDD:409353
Ig 458..533 CDD:472250
Ig strand B 459..463 CDD:409353
Ig strand C 472..476 CDD:409353
Ig strand E 497..503 CDD:409353
Ig strand F 513..518 CDD:409353
Ig 671..>742 CDD:472250
Ig strand B 674..678 CDD:409353
Ig strand C 687..691 CDD:409353
Ig strand E 717..721 CDD:409353
Ig strand F 731..736 CDD:409353
Ig 779..851 CDD:472250
Ig strand B 781..785 CDD:409570
Ig strand C 794..798 CDD:409570
Ig strand E 816..821 CDD:409570
Ig strand F 831..836 CDD:409570
Ig strand G 844..847 CDD:409570
Protein Kinases, catalytic domain 927..1332 CDD:473864
FGFR4NP_002002.3 Ig_3 36..104 CDD:464046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..148
IgI_2_FGFR 147..241 CDD:409443 3/7 (43%)
Ig strand A 147..150 CDD:409443
Ig strand A' 158..163 CDD:409443
Ig strand B 167..175 CDD:409443
Ig strand C 181..186 CDD:409443
Ig strand C' 189..191 CDD:409443
Ig strand D 200..203 CDD:409443
Ig strand E 207..212 CDD:409443
Ig strand F 221..228 CDD:409443
Ig strand G 231..241 CDD:409443 3/7 (43%)
Ig 249..351 CDD:472250 19/94 (20%)
Ig strand B 267..271 CDD:409444 1/3 (33%)
Ig strand C 280..284 CDD:409444 0/3 (0%)
Ig strand E 316..320 CDD:409444 0/3 (0%)
Ig strand F 330..335 CDD:409444 1/2 (50%)
Ig strand G 343..346 CDD:409444
Protein Kinases, catalytic domain 454..767 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.