DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and CEACAM20

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:XP_011524731.1 Gene:CEACAM20 / 125931 HGNCID:24879 Length:623 Species:Homo sapiens


Alignment Length:608 Identity:130/608 - (21%)
Similarity:214/608 - (35%) Gaps:187/608 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 YGMEWFTPSRDENRIFASQSRTDPKTRN---------STHQ--TGRSTLTV----------LNAQ 404
            :|..|.       .|..|..|.||..|.         ||.:  ...|..||          |||.
Human     7 WGHHWM-------GILLSGQRQDPVRRKPEGRGHGRLSTERLPVSASLCTVWSPPAAAQLTLNAN 64

  Fly   405 PSDTGLYKCVTTDNSNQNVQRATYRIKVLKQNESYLNVGEPSGHYNVQEYANRTIQMTANFEGFP 469
            |.|.         ..:::|....:              |.|           ||.|:........
Human    65 PLDA---------TQSEDVVLPVF--------------GTP-----------RTPQIHGRSRELA 95

  Fly   470 TPSFSWFKPDGTEVRQSE-------------------NNFKILSTE---LS---TMLQVLNAQLQ 509
            .||.: ..| ||.:.|.:                   ||..|:..|   ||   .:|.:|..|.:
Human    96 KPSIA-VSP-GTAIEQKDMVTFYCTTKDVNITIHWVSNNLSIVFHERMQLSKDGKILTILIVQRE 158

  Fly   510 DSGTYVLRGSNSFGVVQREYNVSV-----MDAPALKM-----SDAYVQV--GSVARLECTVRSYP 562
            |||||.....::. :.||...:.:     .|...:|:     |...|:|  ||........:|:|
Human   159 DSGTYQCEARDAL-LSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVMEGSSMTFLAETKSHP 222

  Fly   563 PAIVTFFFRPCSLEPQWPTCSVLNQNFSLPSEQEKYQFQTRPRPGKLSVERIYEVSFLPTEPGIL 627
            |...|:|.....|       |...:.|::.                 :|.|.:|        |:.
Human   223 PCAYTWFLLDSIL-------SHTTRTFTIH-----------------AVSREHE--------GLY 255

  Fly   628 TCIAQN---------IIDGKERRTLTKAHVLLG--NISENMTIYGFDKDHKIAKEDNVNFTCEAL 681
            .|:..|         .:..:...|||...|:..  |:.||..              :|:.||:.:
Human   256 RCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENAR--------------SVDLTCQTV 306

  Fly   682 AYHFDGNLKWFINGEDLKESDSVHIETSHTKYSYKSTVHITTISDRDRGTYECRAYHNDKDAVYS 746
              :...|::||::|:.|..|:  |::.|    :...|:.|..:...|.|.|.|..::....|  .
Human   307 --NQSVNVQWFLSGQPLLPSE--HLQLS----ADNRTLIIHGLQRNDTGPYACEVWNWGSRA--R 361

  Fly   747 SREIDLYV-HDPSAPQWT-NGGQEGHSKIKRKLSQTLELECASTAVPVAIVRWFKDDKEVTESKL 809
            |..::|.: :.|.....| ....|..|.|:.:|:.:|.|:|.:.:.|.|..||     .:..|..
Human   362 SEPLELTINYGPDQVHITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRW-----TLEHSTG 421

  Fly   810 RHIIEKESKLLITHLYPGDEGVYKCVVENRLDRIERSFTVVI-------SDLPGISMAWVWFGVI 867
            .|:.|   :|:|..|....:|:|.|...|.|..:.||.:|::       |.|...::|.:..|::
Human   422 EHLGE---QLIIRALTWEHDGIYNCTASNSLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGIL 483

  Fly   868 LFLILIG-LCVFLAVRYQKEHKR 889
            ..:.:.. |..||.:|..:...|
Human   484 AVIAVASELGYFLCIRNARRPSR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652 19/91 (21%)
Ig <363..432 CDD:299845 18/89 (20%)
Ig 466..533 CDD:299845 22/91 (24%)
IG_like 672..754 CDD:214653 20/81 (25%)
Ig 674..739 CDD:143165 17/64 (27%)
IGc2 779..840 CDD:197706 17/60 (28%)
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
CEACAM20XP_011524731.1 Ig 96..183 CDD:299845 22/89 (25%)
IG_like 97..170 CDD:214653 20/74 (27%)
Ig_2 202..274 CDD:290606 18/103 (17%)
IG_like 202..274 CDD:214653 18/103 (17%)
Ig 293..370 CDD:299845 22/100 (22%)
IG_like 388..460 CDD:214653 24/79 (30%)
Ig_2 396..462 CDD:290606 21/73 (29%)
C_Hendra 499..>554 CDD:293426 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.