DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvr and si:zfos-1069f5.1

DIOPT Version :9

Sequence 1:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster
Sequence 2:XP_009305955.1 Gene:si:zfos-1069f5.1 / 103912059 ZFINID:ZDB-GENE-141215-70 Length:449 Species:Danio rerio


Alignment Length:469 Identity:102/469 - (21%)
Similarity:167/469 - (35%) Gaps:143/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IILDAQTSTTLKCEDDEPMSWWTSQSQYVHVKSFDNTEDPARPFGTSLHLIE-VTADYVAAYYCV 119
            :|||:.:...|.||.|.|:::....::  |.:.........|.|     |:| .|.|:...|.||
Zfish    36 VILDSGSPLQLVCEGDGPVTFLPRLAK--HKRYISKEVGKIRSF-----LVEKATVDFTGTYKCV 93

  Fly   120 KTSKFSQIAKEEQSDEAMIELVNQGYASSIYVYVND-------PDTKLVDSHNVVTARQYTDVVI 177
            ..:         .:|..:        :||::|:|.|       |.|.|     ....::..|:::
Zfish    94 YMN---------GNDSNL--------SSSVHVFVRDSRVLFVSPSTSL-----RYVRKEGEDLLL 136

  Fly   178 PCKPAMPDTEVLLETSNGEMHSSKSVG---RYDPQRGFTIEIRSIVDG--GDYYCRPN------- 230
            ||  .:.|.|....|...:..|:...|   .|||::|  :.||....|  |:|.|...       
Zfish   137 PC--LLTDPEATNFTFRMDNVSAAPYGMNITYDPRKG--VLIRKAHPGFNGEYICSARIRGIEKV 197

  Fly   231 --------------PPFPH---NEEEMTSIEVRFIATGLDIPRTQTT-----NMVYTYAPGVTDG 273
                          ||:.:   ||      .|:.:...|.|..|...     |:.:|::..:...
Zfish   198 SKIFSINIIQRLRFPPYVYLKRNE------YVKLVGERLQISCTTNNPNFYYNVTWTHSSRMLPK 256

  Fly   274 DDE-------------VLTV--TNQS-TGNLALI----RGGDGTLSRERARRSP-ARLAPMNASP 317
            .:|             :||:  ..|| |||:...    .|.:.:.::......| .||:|..:|.
Zfish   257 AEEKSTMEVDHLAIESILTIPSVQQSHTGNITCTGQNEAGANSSTTQLLVVEEPYIRLSPKLSSK 321

  Fly   318 SPRPGQDGKPLPKPVIRSSVEHHVFTDTNFTLDCEQSAYVESVYGMEWFTP-----SRDENRIFA 377
            ....|            .|:|.....|.:..:..|  || ..:...:|.||     |..|||.|.
Zfish   322 LTHRG------------LSIEVSEGDDVDLGVLIE--AY-PPLTSHKWETPTSHNASLPENRFFN 371

  Fly   378 SQSRTDP----KTRNSTHQTGRSTLTVLNAQPS-----DTGLYKCVTTDNSNQNVQRATYRIKVL 433
            ...|.:.    |:.| ..:.|:.||.|.|:..:     |..:||     :::...|..|      
Zfish   372 HNDRYEALLFLKSLN-FEEIGQYTLNVKNSMKNASITFDIKMYK-----STSVKAQWTT------ 424

  Fly   434 KQNESYLNVGEPSG 447
            .|:|...|..|..|
Zfish   425 GQSEDKTNCDETRG 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvrNP_001162911.1 IG 346..432 CDD:214652 24/99 (24%)
Ig <363..432 CDD:299845 21/82 (26%)
Ig 466..533 CDD:299845
IG_like 672..754 CDD:214653
Ig 674..739 CDD:143165
IGc2 779..840 CDD:197706
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
si:zfos-1069f5.1XP_009305955.1 Ig_2 31..110 CDD:316418 22/97 (23%)
IG_like 126..200 CDD:214653 18/77 (23%)
IG_like 222..306 CDD:214653 15/83 (18%)
Ig 311..410 CDD:325142 27/114 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11782
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126783at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.