DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and SNX1

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_196232.1 Gene:SNX1 / 830501 AraportID:AT5G06140 Length:402 Species:Arabidopsis thaliana


Alignment Length:402 Identity:97/402 - (24%)
Similarity:167/402 - (41%) Gaps:78/402 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NGSGSATSPDSSSSAP------ATPAVLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDN 106
            |.|||..||.|.||.|      ..|..|| |.:...||          :.|.|:|.||.:...:.
plant     9 NISGSMQSPRSPSSHPYLSVSVTDPVKLG-NGVQAYIS----------YRVITKTNLPEYQGPEK 62

  Fly   107 NVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSEL 171
            .|:|::.:||||.||:.|.  |.|..|||.|.:                   ...|:|:     .
plant    63 IVIRRYSDFVWLRDRLFEK--YKGIFIPPLPEK-------------------SAVEKFR-----F 101

  Fly   172 EAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQD-----------LCAKPRKKMAI 225
            .||::...:   |..::|:.|:|.||..:..:.|:.||:.|::           :..||...|.:
plant   102 SAEFIEMRR---AALDIFVNRIALHPELQQSEDLRTFLQADEETMDRFRFQETSIFKKPADLMQM 163

  Fly   226 FGGFVKSLGKTTDEIL-LSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQ 289
            |.. |:|  |.:|.:| ....|.:....:|....::.|...||.||.....::.:||:::|.|..
plant   164 FRD-VQS--KVSDAVLGKEKPVEETTADYEKLKHYIFELENHLTEAQKHAYRLVKRHRELGQSLL 225

  Fly   290 KISNALTQLSTTE---KGNVETFVAKTAEIFE-RIKNLETRVASDQDLKLGDTLRYYQRDSDAAK 350
            ....|:..|...|   .|...:.:...:|:.. :::....:|..:.:..|.|.:||.|    :.|
plant   226 DFGKAVKLLGACEGEPTGKAFSDLGTKSELLSIKLQKEAQQVLMNFEEPLKDYVRYVQ----SIK 286

  Fly   351 ALLIRRLRCLAAY-------EAANRNLEKARSKNKDV--HAPLEVQEAETAQAEACEKFESMSAC 406
            |.:..|......:       :....||:|......|.  .|.:|.:|.:....||..:||.:...
plant   287 ATIAERGTAFKQHCELSETTKLKEINLDKLMLTRSDKVGEAEIEYREIKAESEEATRRFERIVKR 351

  Fly   407 GKEELIGFRNRR 418
            .::|::.|:.::
plant   352 MEDEIVRFQEQK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 36/139 (26%)
BAR_SNX5_6 228..452 CDD:153305 43/205 (21%)
SNX1NP_196232.1 PX_SNX1_2_like 26..139 CDD:132769 39/152 (26%)
BAR_SNX 184..394 CDD:153280 37/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.