DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx8b

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_009304805.1 Gene:snx8b / 799225 ZFINID:ZDB-GENE-090313-317 Length:418 Species:Danio rerio


Alignment Length:324 Identity:64/324 - (19%)
Similarity:102/324 - (31%) Gaps:119/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ISDALSEKE---KVKFTVHTRTT-LPGFSKKDNNVV---------RQHEEFVWLHDRIEENDDYA 129
            :.|.||.||   .|...:..|.. ||.....:..:|         |::.:|...|..:.:...|.
Zfish     9 LMDGLSLKELGDSVLVEIEPRRKGLPFLKHVEYRIVSKCFQIPVQRRYSDFEVFHGLLLQKFIYR 73

  Fly   130 GYIIPPCPPR------------PDFDASREK-LQRLGEGEGNMTKEEFKKMKSELEAEYLATFKK 181
              ::||.||:            .:|:.||.: |||                              
Zfish    74 --MVPPLPPKRILKGVLNSLSDREFNDSRRRGLQR------------------------------ 106

  Fly   182 TVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATV 246
                   |:..:..|||...||.:.:||....   |..:.|:.      .|..||.||.|:|...
Zfish   107 -------FMTLVIRHPVLAGDQLVNIFLSASS---ADVQNKLR------DSYKKTGDEFLISQIA 155

  Fly   247 RDVNDFFENELQ--------FLTEYHG---HLREAALRTEKMTQRHKDVGDSHQKISNALTQL-- 298
            .....:...::|        .:...|.   .||:.|   |:|.||.::...........|::|  
Zfish   156 LHGKVYLPEDIQSQAAANREVIASIHSSFYKLRDVA---ERMAQRSRENSTDLLMFGKDLSELGS 217

  Fly   299 ---------------STTEKGNVE------TFVAKTA--------EIFERIKNLETRVASDQDL 333
                           .|..|..||      ....|.|        |:.|::..|..::.|.:||
Zfish   218 DTSDLPEDAIVSKAWKTQRKSLVELSGEFGLLADKAAHQGTREEDEVVEKLNLLLEQLQSYKDL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 32/159 (20%)
BAR_SNX5_6 228..452 CDD:153305 30/148 (20%)
snx8bXP_009304805.1 PX_SNX8_Mvp1p_like 20..130 CDD:132776 27/148 (18%)
BAR_SNX8 147..385 CDD:153281 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.