DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx11

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001156861.1 Gene:Snx11 / 74479 MGIID:1921729 Length:271 Species:Mus musculus


Alignment Length:169 Identity:36/169 - (21%)
Similarity:61/169 - (36%) Gaps:49/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ENALHVEISDALSEKE-----KVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAG 130
            |..:.|.:.|...:.|     .|.:.:...|....|:.|.:.|.|::.|||||..:::.|   ||
Mouse    14 EEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRN---AG 75

  Fly   131 YIIPPCPPRPD----FDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLR 191
            .:  |.|..|.    |..|.|.:::..:|                            ..|  ||.
Mouse    76 LV--PVPELPGKSTFFGGSDEFIEKRRQG----------------------------LQH--FLE 108

  Fly   192 RLASHPVFRVDQHLKVFLEY-----DQDLCAKPRKKMAI 225
            ::....|...|..|.:||:.     :.:.|.:.|..|.:
Mouse   109 KVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRGAMTV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 32/153 (21%)
BAR_SNX5_6 228..452 CDD:153305
Snx11NP_001156861.1 PX_SNX10 18..129 CDD:132808 32/145 (22%)
Important for membrane trafficking. /evidence=ECO:0000250 135..139 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.