DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx6

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_081274.2 Gene:Snx6 / 72183 MGIID:1919433 Length:406 Species:Mus musculus


Alignment Length:379 Identity:210/379 - (55%)
Similarity:282/379 - (74%) Gaps:7/379 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCP 137
            ||.|:|||||||:::|||||||:::||.|.:.:.:||||||||:||||...||:|||||||||.|
Mouse    31 ALQVDISDALSERDRVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAP 95

  Fly   138 PRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVD 202
            |||||||||||||:||||||:||||||.|||.||||||||.||||||||||||.|:|:||:.|.|
Mouse    96 PRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKD 160

  Fly   203 QHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQFLTEYHGHL 267
            .:..|||||:|||..:.:.|......|.|::.|:.|.:::|. |:||:||||:|..||.|||..:
Mouse   161 LNFHVFLEYNQDLSVRGKN
KKEKLEDFFKNMVKSADGVIVSG-VKDVDDFFEHERTFLLEYHNRV 224

  Fly   268 REAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVETFVAKTAEIFERIKNLETRVASDQD 332
            ::|:.::::||:.||...|.:.:|.::|..|.|.:..::..|..|.:|:|::.:.:|.||::|:|
Mouse   225 KDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADED 289

  Fly   333 LKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEAC 397
            |||.|.|:||.|:|.|||.||.||.|.|..||.||:.|:|||:||||      |.:|||:|...|
Mouse   290 LKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKD------VLQAETSQQLCC 348

  Fly   398 EKFESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSLLAL 451
            :|||.:|...|:|||.|:.||||||:|:||||:|||:||||...:.|:..|..|
Mouse   349 QKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 102/138 (74%)
BAR_SNX5_6 228..452 CDD:153305 103/224 (46%)
Snx6NP_081274.2 Interaction with PIM1. /evidence=ECO:0000250|UniProtKB:Q9UNH7 2..179 106/147 (72%)
PX_SNX6 30..170 CDD:132825 102/138 (74%)
Phosphatidylinositol bisphosphate binding. /evidence=ECO:0000250|UniProtKB:B1H267 41..47 2/5 (40%)
Phosphatidylinositol bisphosphate binding. /evidence=ECO:0000250|UniProtKB:B1H267 100..106 5/5 (100%)
Phosphatidylinositol bisphosphate binding. /evidence=ECO:0000250|UniProtKB:B1H267 114..117 2/2 (100%)
Membrane-binding amphipathic helix. /evidence=ECO:0000250|UniProtKB:Q9UNH7 182..199 4/16 (25%)
BAR_SNX6 186..403 CDD:153346 100/216 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2642
eggNOG 1 0.900 - - E1_KOG1660
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12304
Inparanoid 1 1.050 424 1.000 Inparanoid score I1748
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52498
OrthoDB 1 1.010 - - D1009572at2759
OrthoFinder 1 1.000 - - FOG0004890
OrthoInspector 1 1.000 - - otm43491
orthoMCL 1 0.900 - - OOG6_105967
Panther 1 1.100 - - O PTHR45850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3071
SonicParanoid 1 1.000 - - X1564
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.870

Return to query results.
Submit another query.