DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx3

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001037748.1 Gene:Snx3 / 684097 RGDID:1595151 Length:162 Species:Rattus norvegicus


Alignment Length:163 Identity:35/163 - (21%)
Similarity:72/163 - (44%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TSPDSSSSAPATPAVLGENALHVEISD----ALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEE 114
            |.|.:.:.|...|:    |.|.:::|:    .:.......:.:..:|.||.|..|::.|.|::.:
  Rat    13 TKPQNLNDAYGPPS----NFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSD 73

  Fly   115 FVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLG-EGEGNMTKEEF-KKMKSELEAEYLA 177
            |.||...:|..   :..::||.|       .:..|::|. .|:..:..:.| ::.|..||.    
  Rat    74 FEWLRSELERE---SKVVVPPLP-------GKAFLRQLPFRGDDGIFDDNFIEERKQGLEQ---- 124

  Fly   178 TFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLE 210
                       |:.::|.||:.:.::.|.:||:
  Rat   125 -----------FINKVAGHPLAQNERCLHMFLQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 31/145 (21%)
BAR_SNX5_6 228..452 CDD:153305
Snx3NP_001037748.1 PX_SNX3 28..150 CDD:132826 30/144 (21%)
Binds predominantly to PtdIns(P5) and weaker to PtdIns(P3) abd PtdIns(P4), involved in neurite outgrowth regulation. /evidence=ECO:0000250|UniProtKB:O70492 147..162 35/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.