DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx2

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001344392.1 Gene:Snx2 / 67804 MGIID:1915054 Length:523 Species:Mus musculus


Alignment Length:541 Identity:128/541 - (23%)
Similarity:205/541 - (37%) Gaps:147/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TNNGATMEIASPTNPLATPPATGGAPAPSGATNGSG---------------------SATSPD-- 57
            |:..:|:| :||::|   .||:..|...|..:|||.                     |..||:  
Mouse    29 TSTVSTLE-SSPSSP---EPASLPAEDISANSNGSKPVEVVLDDDREDLFAEATEEVSLDSPERE 89

  Fly    58 ---SSSSAPA----TPAVL-------------------------GENALHVEISDALSEKEKV-- 88
               ||..:||    ||..|                         ..|....:|...:|:.|||  
Mouse    90 LILSSEPSPAVTPVTPTTLIAPRIESKSISAPVIFDRSRDEIEEEANGDIFDIEIGVSDPEKVGD 154

  Fly    89 ------KFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASRE 147
                  .:.|.|:|:|..|||.:.:|.|:..:|:.||.::.....:.|||:||.|.:.....::.
Mouse   155 GMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKV 219

  Fly   148 KLQRLGEGEGNMTKEEF-KKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEY 211
            |:     |:.:.:..|| :|.::.||.               :|:|...||....|..|:.|||.
Mouse   220 KV-----GKEDSSSTEFVEKRRAALER---------------YLQRTVKHPTLLQDPDLRQFLES 264

  Fly   212 DQDLCAKPR--KKMAIFG-GFVKSLGKTTDEILLSATVRDVNDF--------FENELQFLTEYHG 265
            .:    .||  ...|:.| |.::.:.|..|.:.......:.:|.        |||..|.|.:.|.
Mouse   265 SE----LPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHA 325

  Fly   266 -------HLREAALRTEKMTQRHKDVGDS--HQKISNALTQLSTTEKGNVETFVAKTAEIFERIK 321
                   |.:|.:..|....:....:|:|  |..:|.||:||               ||:.|:|.
Mouse   326 SVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQL---------------AEVEEKID 375

  Fly   322 NLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKAR------------ 374
            .|....|........:.|..|.|...|.|.:...|::|...:|.|...|.|.|            
Mouse   376 QLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKP 440

  Fly   375 -----SKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVELSELEI 434
                 :|| ::...:|..||:..|.|  ..||.:|...::|:..|...||..||..:::..|..:
Mouse   441 DKIQQAKN-EIREEIEEWEAKVQQGE--RDFEQISKTIRKEVGRFEKERVKDFKAVIIKYLESLV 502

  Fly   435 KHAKTQYEYLRQSLLALKEIA 455
            :..:...:|....|...|.||
Mouse   503 QTQQQLIKYWEAFLPEAKAIA 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 40/148 (27%)
BAR_SNX5_6 228..452 CDD:153305 58/257 (23%)
Snx2NP_001344392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..62 12/35 (34%)
Sorting_nexin <49..112 CDD:308990 15/62 (24%)
PX_SNX2 142..265 CDD:132815 39/142 (27%)
Membrane-binding amphipathic helix. /evidence=ECO:0000250|UniProtKB:O60749 278..295 4/16 (25%)
BAR 283..520 CDD:325158 57/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.