DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and SNX2

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_003091.2 Gene:SNX2 / 6643 HGNCID:11173 Length:519 Species:Homo sapiens


Alignment Length:536 Identity:118/536 - (22%)
Similarity:211/536 - (39%) Gaps:122/536 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGTD-----DSNLLNSPSTNNGATM---EIASPTN------------------------PLATP- 34
            ||.|     .|.|.:|||:...|::   :|::.:|                        .|.:| 
Human    23 DGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPKPTEVVLDDDREDLFAEATEEVSLDSPE 87

  Fly    35 --PATGGAPAPSGATNGSGSATSPDSSSSAPATPAVLGENALHVE---------ISDALSEKEKV 88
              |.....|:|:.......:..:|...|.:.:.|.:...:...:|         |...:|:.|||
Human    88 REPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPEKV 152

  Fly    89 --------KFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDAS 145
                    .:.|.|:|:|..|||.:.:|.|:..:|:.||.::.....:.|||:||.|.:.....:
Human   153 GDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMT 217

  Fly   146 REKLQRLGEGEGNMTKEEF-KKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFL 209
            :.|:     |:.:.:..|| :|.::.||.               :|:|...||....|..|:.||
Human   218 KVKV-----GKEDSSSTEFVEKRRAALER---------------YLQRTVKHPTLLQDPDLRQFL 262

  Fly   210 EYDQDLCAKPR--KKMAIFG-GFVKSLGKTTDEI-LLSATVRDVNDFFENELQFLTEYHGHLREA 270
            |..:    .||  ...|:.| |.::.:.|..|.: .::..:.:.:.:||.:.|........||:.
Human   263 ESSE----LPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKL 323

  Fly   271 ALRTEKMTQRHKDV----------------GDSHQKISNALTQLSTTEKGNVETFVAKTAEIFER 319
            .:..|.:....|::                .:.|..:|.||:||               ||:.|:
Human   324 HVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQL---------------AEVEEK 373

  Fly   320 IKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEK---ARSKNKDVH 381
            |..|....|........:.|..|.|...|.|.:...|::|...:|.|...|.|   |.:|....:
Human   374 IDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVAN 438

  Fly   382 APLEVQEAET------AQAEACEK-FESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKT 439
            .|.::|:|:.      |:.:..|: ||.:|...::|:..|...||..||..:::..|..::..:.
Human   439 KPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQ 503

  Fly   440 QYEYLRQSLLALKEIA 455
            ..:|....|...|.||
Human   504 LIKYWEAFLPEAKAIA 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 40/157 (25%)
BAR_SNX5_6 228..452 CDD:153305 52/250 (21%)
SNX2NP_003091.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 16/80 (20%)
Sorting_nexin 2..134 CDD:367612 20/110 (18%)
PX_SNX2 142..265 CDD:132815 39/142 (27%)
Interaction with RhoG. /evidence=ECO:0000269|PubMed:20604901 260..519 60/277 (22%)
Membrane-binding amphipathic helix. /evidence=ECO:0000303|PubMed:19816406 278..295 4/16 (25%)
BAR 283..516 CDD:386243 51/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.