DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx16

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_071625.2 Gene:Snx16 / 64088 RGDID:620295 Length:344 Species:Rattus norvegicus


Alignment Length:279 Identity:59/279 - (21%)
Similarity:107/279 - (38%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DDSNLLNSPSTNNGATMEIASPT--NPLATPPATG-GAPAPSGATNGSGSATSPDSSS--SAPAT 65
            :||::.....||....|:.||..  :||.....|| .:.....|.........||:.:  ..|:|
  Rat    45 EDSSVGTCKHTNVQDQMDSASSVCGSPLIRTKFTGTDSSIEYSARPRDTEEQHPDALNWEDRPST 109

  Fly    66 PAVLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVV-RQHEEFVWLHDRIEE----- 124
            |.:||...:          :|:.||||:  ..|...|.:::.|| |::.:|..|:|:::|     
  Rat   110 PTILGYEVM----------EERAKFTVY--KILVKESPEESWVVFRRYTDFSRLNDKLKEMFPGF 162

  Fly   125 ----------NDDY-AGYI-------------------IPPC-----------PPRPDFDA---S 145
                      .|:| |.::                   |..|           ||.| ||:   |
  Rat   163 RLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGP-FDSLEES 226

  Fly   146 REKLQRLGEGEGNMTKEEFKKMK-----------SELEAEYLATFKKTVAMH---EVFLRRLASH 196
            |...:.|.|...::.:|..:|.|           .:|..:.|.|..:|:::.   .:::.|....
  Rat   227 RAFCETLEETNYHLQRELLEKQKEVESLKKLLGEKQLHIDALETRIRTLSLEPGASLYVSRAEGG 291

  Fly   197 PVFRVDQHLKVFLEYDQDL 215
            .:.||...:   |:.::|:
  Rat   292 QILRVQSSV---LQVNRDV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 39/203 (19%)
BAR_SNX5_6 228..452 CDD:153305
Snx16NP_071625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..105 3/21 (14%)
PX_SNX16 105..214 CDD:132809 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.