DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx18b

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001015063.1 Gene:snx18b / 548603 ZFINID:ZDB-GENE-080213-6 Length:563 Species:Danio rerio


Alignment Length:320 Identity:67/320 - (20%)
Similarity:111/320 - (34%) Gaps:102/320 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DALSEKEK-VKFTVHTRTTLPGFSKKDNNVVRQH-------EEFVWLH-DRIEENDDYAG--YII 133
            |.:|::.| :.:.::..|:.|..||.|   |.||       :|..|.. .|..|.||..|  :.:
Zfish   290 DFISKRRKGLIWWMNHMTSHPVLSKCD---VFQHFLTCSSTDEKAWKQGKRKAEKDDLVGANFFL 351

  Fly   134 PPCPPRPDFDASREKLQRLGEGEGNMTKE------EFKKMKSELEAEYLATFKKTVAMHEVFLRR 192
            ..|||....|.  ::::...||....||:      :.....:|...:.:..|||...        
Zfish   352 TICPPALPLDL--QEVENKVEGFKTFTKKMDENIIQVNVTINEFARKQITGFKKEYQ-------- 406

  Fly   193 LASHPVFRVDQHLKVF---LEYDQDLCAKP-RKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFF 253
                   ||.|..::.   .|.||.:.:.| .|.||..|...:::|                |:|
Zfish   407 -------RVGQAFRLLSQAFEVDQQVFSSPLNKAMANTGEVYETIG----------------DYF 448

  Fly   254 ENE--------LQFLTEYHGHL---------REAALRTEKMTQRH---KD--VGDSHQKISNALT 296
            ..:        ...|..|.|||         ::.||...|.:|:|   ||  .|.......|.::
Zfish   449 AEQPRQDLEPISDLLAIYQGHLANFPDIIHVQKGALTKAKESQKHGEEKDGTAGGGINDRCNIIS 513

  Fly   297 QLSTTE------------KGNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQR 344
            ..:..|            |..::.|:.:....|::|..           ||.:.|..|.:
Zfish   514 CATLAEIQHFHCIRVRDFKAQMQYFLQQQISFFQKITG-----------KLEEALDMYDQ 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 34/151 (23%)
BAR_SNX5_6 228..452 CDD:153305 26/151 (17%)
snx18bNP_001015063.1 SH3 4..58 CDD:302595
PX_domain 219..345 CDD:295365 17/57 (30%)
BAR_3_WASP_bdg 328..561 CDD:287434 55/276 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.