DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx7

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_005162901.1 Gene:snx7 / 431776 ZFINID:ZDB-GENE-040704-77 Length:469 Species:Danio rerio


Alignment Length:434 Identity:101/434 - (23%)
Similarity:168/434 - (38%) Gaps:103/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SGSATSPDSSS---SAPATPAVL-------------GENALHVEISDALSE----KEKVKFTVHT 94
            |...|..|.||   |...:||.:             |...:.|.:.:..|.    :..:.:.|.|
Zfish    40 SKDTTITDGSSFNASMQTSPASMINQYKFEEEEEDVGTKDIFVTVDNPESHVTAIETYITYRVMT 104

  Fly    95 RTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNM 159
            :||...|...:..|.|::::|:||..|:||  .:...|:.|.|                      
Zfish   105 KTTRSEFDSSEFEVRRRYQDFLWLKGRLEE--AHPTLIVHPLP---------------------- 145

  Fly   160 TKEEF--KKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKK 222
              |:|  |.|......:::.|.::  |:|. ||.|:|.||:|...:..|:||....:.....:|:
Zfish   146 --EKFVMKGMVERFNEDFIETRRR--ALHR-FLNRIAEHPIFSSTEDFKIFLTAASEELISHKKQ 205

  Fly   223 MAIFGGFVKSLGKTTDEILLSATVRDVNDFFE--NELQFLTEYHGHLREAALRTEKMTQR----- 280
            ..   ||:..:|:|...:  :|:||.|.:..|  |::|   ||.....:.....:|:|||     
Zfish   206 GP---GFLSRMGETVKAV--AASVRGVRNRPEEFNDMQ---EYVEAFSQKINSLDKVTQRIIREQ 262

  Fly   281 ------HKDVGDSHQKISNALTQLSTTEKGNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTL 339
                  .|:.|.::...||:..:|:...|...:.......|..|::|.|     :||   |...|
Zfish   263 REYLEELKECGPTYTLWSNSEQELAEPLKNMADCLDRCYKETDEQVKQL-----NDQ---LSPAL 319

  Fly   340 RYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESMS 404
            ..|...::..||::.||....|.:||..                 |....:.|..||..|..|::
Zfish   320 HEYVLCTETLKAVIRRRDNIQADFEAKT-----------------EALATKKADREADSKVLSLA 367

  Fly   405 ACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSL 448
               .:.|:|   |.....|:...:..:.|||..|...|.|...|
Zfish   368 ---WDSLVG---RSPEEVKQQRQQKLKAEIKEMKDDLEKLEDRL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 35/145 (24%)
BAR_SNX5_6 228..452 CDD:153305 56/234 (24%)
snx7XP_005162901.1 PX_SNX7 80..195 CDD:132817 35/143 (24%)
BAR 179..455 CDD:299863 63/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.