DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx3

DIOPT Version :10

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:82/174 - (47%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TNGSGSAT-----SPDSSSSAPATPAVLGENALHVEISDALS-----EKEKVKFTVHTRTTLPGF 101
            ::|:..||     ...:...|.|.||    |.|.:::.:.|:     :|....:.|..||.||.|
  Fly     5 SDGTADATRRLNVKKQTLDDAYAVPA----NFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVF 65

  Fly   102 SKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKK 166
            ..|:::|.|::.:|.||.:.:|.:   :..::||.|.:    |.:.::...|: ||...:...::
  Fly    66 KVKESSVRRRYSDFEWLRNELERD---SKIVVPPLPGK----AWKRQMPFRGD-EGIFDESFIEE 122

  Fly   167 MKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLE 210
            .:..|||               |:.::|.||:.:.::.|.:||:
  Fly   123 RRKGLEA---------------FINKIAGHPLAQNERCLHMFLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 34/144 (24%)
BAR_SNX5_6 228..452 CDD:153305
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 33/143 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.