DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx3

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:82/174 - (47%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TNGSGSAT-----SPDSSSSAPATPAVLGENALHVEISDALS-----EKEKVKFTVHTRTTLPGF 101
            ::|:..||     ...:...|.|.||    |.|.:::.:.|:     :|....:.|..||.||.|
  Fly     5 SDGTADATRRLNVKKQTLDDAYAVPA----NFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVF 65

  Fly   102 SKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKK 166
            ..|:::|.|::.:|.||.:.:|.:   :..::||.|.:    |.:.::...|: ||...:...::
  Fly    66 KVKESSVRRRYSDFEWLRNELERD---SKIVVPPLPGK----AWKRQMPFRGD-EGIFDESFIEE 122

  Fly   167 MKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLE 210
            .:..|||               |:.::|.||:.:.::.|.:||:
  Fly   123 RRKGLEA---------------FINKIAGHPLAQNERCLHMFLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 34/144 (24%)
BAR_SNX5_6 228..452 CDD:153305
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 33/143 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.